BLASTX nr result
ID: Cocculus22_contig00023763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023763 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207083.1| hypothetical protein PRUPE_ppa024338mg, part... 140 1e-31 ref|XP_004296321.1| PREDICTED: pentatricopeptide repeat-containi... 140 2e-31 ref|XP_002300388.2| hypothetical protein POPTR_0001s37860g [Popu... 139 3e-31 ref|XP_004955182.1| PREDICTED: pentatricopeptide repeat-containi... 137 2e-30 ref|XP_006452639.1| hypothetical protein CICLE_v10010822mg [Citr... 136 3e-30 ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containi... 136 3e-30 ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containi... 136 3e-30 gb|EXC21533.1| hypothetical protein L484_014888 [Morus notabilis] 135 8e-30 gb|EXB50999.1| hypothetical protein L484_023701 [Morus notabilis] 135 8e-30 gb|EYU35808.1| hypothetical protein MIMGU_mgv1a021697mg, partial... 132 4e-29 ref|XP_006474838.1| PREDICTED: pentatricopeptide repeat-containi... 132 5e-29 ref|XP_004244339.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 emb|CBI39775.3| unnamed protein product [Vitis vinifera] 129 5e-28 ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containi... 129 5e-28 ref|XP_007020439.1| Tetratricopeptide repeat-like superfamily pr... 124 1e-26 ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, par... 124 2e-26 gb|AEB39777.1| pentatricopeptide repeat protein 91 [Funaria hygr... 124 2e-26 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 123 2e-26 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 123 2e-26 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 123 2e-26 >ref|XP_007207083.1| hypothetical protein PRUPE_ppa024338mg, partial [Prunus persica] gi|462402725|gb|EMJ08282.1| hypothetical protein PRUPE_ppa024338mg, partial [Prunus persica] Length = 611 Score = 140 bits (354), Expect = 1e-31 Identities = 65/77 (84%), Positives = 68/77 (88%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 QKE L+RHSEKLA+V+GLM T GTPIRIMKNLRVCEDCHAA KLIS I REIVVRDR Sbjct: 535 QKEKFLYRHSEKLALVFGLMNTGPGTPIRIMKNLRVCEDCHAAFKLISAIVNREIVVRDR 594 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFKDGSCSCRDYW Sbjct: 595 NRFHCFKDGSCSCRDYW 611 >ref|XP_004296321.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 465 Score = 140 bits (353), Expect = 2e-31 Identities = 64/77 (83%), Positives = 71/77 (92%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 QKE L RHSEKLA+V+GL+KT GTPIRIMKNLRVCEDCHAALKL+SEI++REIVVRDR Sbjct: 389 QKEKFLSRHSEKLALVFGLIKTKPGTPIRIMKNLRVCEDCHAALKLVSEIAEREIVVRDR 448 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFK+G CSCRDYW Sbjct: 449 NRFHCFKNGYCSCRDYW 465 >ref|XP_002300388.2| hypothetical protein POPTR_0001s37860g [Populus trichocarpa] gi|550349131|gb|EEE85193.2| hypothetical protein POPTR_0001s37860g [Populus trichocarpa] Length = 595 Score = 139 bits (351), Expect = 3e-31 Identities = 62/77 (80%), Positives = 69/77 (89%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE L+RHSEKLAVV+GLM TP GTPIRIMKNLRVCEDCHAALK+IS I REI+VRDR Sbjct: 519 EKEKFLYRHSEKLAVVFGLMTTPEGTPIRIMKNLRVCEDCHAALKIISGIVSREIIVRDR 578 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCF+DG CSCRD+W Sbjct: 579 NRFHCFRDGQCSCRDFW 595 >ref|XP_004955182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Setaria italica] Length = 548 Score = 137 bits (344), Expect = 2e-30 Identities = 61/77 (79%), Positives = 69/77 (89%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE VL RHSEKLAV +GLM TP GT +R+MKNLRVC DCHAA+KLISEI++REIVVRDR Sbjct: 472 EKERVLARHSEKLAVAFGLMATPPGTTLRVMKNLRVCSDCHAAMKLISEITRREIVVRDR 531 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFK+G CSCRDYW Sbjct: 532 NRFHCFKNGICSCRDYW 548 >ref|XP_006452639.1| hypothetical protein CICLE_v10010822mg [Citrus clementina] gi|557555865|gb|ESR65879.1| hypothetical protein CICLE_v10010822mg [Citrus clementina] Length = 625 Score = 136 bits (343), Expect = 3e-30 Identities = 62/77 (80%), Positives = 67/77 (87%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE L+RHSEKLA+ +GLM TP GTPIRIMKNLRVCEDCHAA KLISEI REIVVRDR Sbjct: 549 EKEKFLYRHSEKLALTFGLMNTPPGTPIRIMKNLRVCEDCHAAFKLISEIVNREIVVRDR 608 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCF+ GSCSC DYW Sbjct: 609 NRFHCFQAGSCSCGDYW 625 >ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 583 Score = 136 bits (343), Expect = 3e-30 Identities = 63/77 (81%), Positives = 69/77 (89%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 QKE L+RHSEKLAVV+GL+KT GT IRIMKNLRVCEDCHAALK+IS +S REIVVRDR Sbjct: 507 QKEKFLYRHSEKLAVVFGLIKTTPGTVIRIMKNLRVCEDCHAALKIISVVSTREIVVRDR 566 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFK+GSCSC DYW Sbjct: 567 NRFHCFKNGSCSCGDYW 583 >ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 617 Score = 136 bits (343), Expect = 3e-30 Identities = 63/77 (81%), Positives = 69/77 (89%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 QKE L+RHSEKLAVV+GL+KT GT IRIMKNLRVCEDCHAALK+IS +S REIVVRDR Sbjct: 541 QKEKFLYRHSEKLAVVFGLIKTTPGTVIRIMKNLRVCEDCHAALKIISVVSTREIVVRDR 600 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFK+GSCSC DYW Sbjct: 601 NRFHCFKNGSCSCGDYW 617 >gb|EXC21533.1| hypothetical protein L484_014888 [Morus notabilis] Length = 636 Score = 135 bits (339), Expect = 8e-30 Identities = 61/77 (79%), Positives = 68/77 (88%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE L+RHSEKLA+V+GLM T + TPIRIMKNLRVCEDCHAA KL+S I REIVVRDR Sbjct: 560 EKEKFLYRHSEKLALVFGLMNTESETPIRIMKNLRVCEDCHAAFKLLSAIVGREIVVRDR 619 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFKDGSC+CRDYW Sbjct: 620 NRFHCFKDGSCACRDYW 636 >gb|EXB50999.1| hypothetical protein L484_023701 [Morus notabilis] Length = 636 Score = 135 bits (339), Expect = 8e-30 Identities = 63/77 (81%), Positives = 67/77 (87%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE L+RHSEKLA+V+GLM T GTPIRIMKNLRVCEDCHAA KLIS I REIVVRDR Sbjct: 560 EKEKFLYRHSEKLALVFGLMNTEPGTPIRIMKNLRVCEDCHAAFKLISAIVGREIVVRDR 619 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFH FKDGSCSCRDYW Sbjct: 620 NRFHYFKDGSCSCRDYW 636 >gb|EYU35808.1| hypothetical protein MIMGU_mgv1a021697mg, partial [Mimulus guttatus] Length = 598 Score = 132 bits (333), Expect = 4e-29 Identities = 61/77 (79%), Positives = 67/77 (87%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE VLFRHSEKLA+V+GL+ +P G IRI KNLRVCEDCHA+ KLISEI REIVVRDR Sbjct: 522 EKEKVLFRHSEKLALVFGLISSPPGQTIRIFKNLRVCEDCHASFKLISEIVDREIVVRDR 581 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFH FKDGSCSCRDYW Sbjct: 582 NRFHTFKDGSCSCRDYW 598 >ref|XP_006474838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] Length = 624 Score = 132 bits (332), Expect = 5e-29 Identities = 61/76 (80%), Positives = 66/76 (86%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE L+RHSEKLA+ +GLM TP GTPIRIMKNLRVCEDCHAA KLISEI REIVVRDR Sbjct: 549 EKEKFLYRHSEKLALTFGLMNTPPGTPIRIMKNLRVCEDCHAAFKLISEIVNREIVVRDR 608 Query: 122 NRFHCFKDGSCSCRDY 75 NRFHCF+ GSCSC DY Sbjct: 609 NRFHCFQAGSCSCGDY 624 >ref|XP_004244339.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 626 Score = 130 bits (327), Expect = 2e-28 Identities = 59/77 (76%), Positives = 65/77 (84%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE ++RHSEKLA+VYGLM G IRIMKNLRVCEDCH A K+ISEI KREIVVRDR Sbjct: 550 EKEKYVYRHSEKLALVYGLMNIKPGETIRIMKNLRVCEDCHEAFKVISEIVKREIVVRDR 609 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCFKDG CSC+DYW Sbjct: 610 NRFHCFKDGFCSCKDYW 626 >emb|CBI39775.3| unnamed protein product [Vitis vinifera] Length = 599 Score = 129 bits (323), Expect = 5e-28 Identities = 58/77 (75%), Positives = 64/77 (83%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +K + RHSEKLA+V+GLM TP TPIRIMKNLR+CEDCH+A KLIS I REIVVRDR Sbjct: 523 EKVKFVSRHSEKLALVFGLMNTPAETPIRIMKNLRICEDCHSAFKLISAIVNREIVVRDR 582 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCF D SCSCRDYW Sbjct: 583 NRFHCFNDNSCSCRDYW 599 >ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 632 Score = 129 bits (323), Expect = 5e-28 Identities = 58/77 (75%), Positives = 64/77 (83%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +K + RHSEKLA+V+GLM TP TPIRIMKNLR+CEDCH+A KLIS I REIVVRDR Sbjct: 556 EKVKFVSRHSEKLALVFGLMNTPAETPIRIMKNLRICEDCHSAFKLISAIVNREIVVRDR 615 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFHCF D SCSCRDYW Sbjct: 616 NRFHCFNDNSCSCRDYW 632 >ref|XP_007020439.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508720067|gb|EOY11964.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 615 Score = 124 bits (312), Expect = 1e-26 Identities = 56/77 (72%), Positives = 64/77 (83%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 +KE L+RHSEKLA+ +GL+ T G IRIMKNLRVCEDCHA KLIS I REIVVRDR Sbjct: 539 EKEKFLYRHSEKLALCFGLINTRPGVVIRIMKNLRVCEDCHATFKLISAIVNREIVVRDR 598 Query: 122 NRFHCFKDGSCSCRDYW 72 +RFHCFKDG+CSC+DYW Sbjct: 599 SRFHCFKDGACSCQDYW 615 >ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] gi|561034681|gb|ESW33211.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] Length = 380 Score = 124 bits (310), Expect = 2e-26 Identities = 54/76 (71%), Positives = 65/76 (85%) Frame = -2 Query: 299 KENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDRN 120 KE+ L+RHSEKLA+ +GL+ TP GTPIRI+KNLRVCEDCH+A K IS++ REIVVRDRN Sbjct: 305 KEDALYRHSEKLAIAFGLLSTPPGTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRN 364 Query: 119 RFHCFKDGSCSCRDYW 72 RFH FK+G CSC D+W Sbjct: 365 RFHHFKNGLCSCGDFW 380 >gb|AEB39777.1| pentatricopeptide repeat protein 91 [Funaria hygrometrica] Length = 890 Score = 124 bits (310), Expect = 2e-26 Identities = 56/77 (72%), Positives = 62/77 (80%) Frame = -2 Query: 302 QKENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDR 123 QKE L HSEKLA+ YGL+KTP GTPIRIMKNLRVC DCH A K IS+I KREIV RD Sbjct: 814 QKERALCHHSEKLAIAYGLLKTPPGTPIRIMKNLRVCGDCHTATKFISKIRKREIVARDA 873 Query: 122 NRFHCFKDGSCSCRDYW 72 NRFH FK+G+CSC D+W Sbjct: 874 NRFHYFKNGTCSCGDFW 890 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 123 bits (309), Expect = 2e-26 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -2 Query: 299 KENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDRN 120 KE+ L +HSEKLA+ + L+KTP GTPIRI+KNLRVC DCH+A K IS+I REIVVRDR+ Sbjct: 491 KEDALNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRH 550 Query: 119 RFHCFKDGSCSCRDYW 72 RFH FKDGSCSCRD+W Sbjct: 551 RFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 123 bits (309), Expect = 2e-26 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -2 Query: 299 KENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDRN 120 KE+ L +HSEKLA+ + L+KTP GTPIRI+KNLRVC DCH+A K IS+I REIVVRDR+ Sbjct: 525 KEDALNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRH 584 Query: 119 RFHCFKDGSCSCRDYW 72 RFH FKDGSCSCRD+W Sbjct: 585 RFHHFKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 123 bits (309), Expect = 2e-26 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -2 Query: 299 KENVLFRHSEKLAVVYGLMKTPTGTPIRIMKNLRVCEDCHAALKLISEISKREIVVRDRN 120 KE+ L +HSEKLA+ + L+KTP GTPIRI+KNLRVC DCH+A K IS+I REIVVRDR+ Sbjct: 554 KEDALNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRH 613 Query: 119 RFHCFKDGSCSCRDYW 72 RFH FKDGSCSCRD+W Sbjct: 614 RFHHFKDGSCSCRDFW 629