BLASTX nr result
ID: Cocculus22_contig00023727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023727 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532508.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002532508.1| conserved hypothetical protein [Ricinus communis] gi|223527783|gb|EEF29884.1| conserved hypothetical protein [Ricinus communis] Length = 154 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/93 (32%), Positives = 44/93 (47%) Frame = -2 Query: 302 ERQNKLIEVETSAGSVAELVPCKEGHCSGRSRXXXXXXXXXXXXXXXXXTSKNVKRGKAK 123 +++ K + S G + E++ CKEGHC+G +R TSKN + G K Sbjct: 39 DKEEKSSLINRSTGGIGEVIICKEGHCTGMNRKLTTVITSATSTSTTSTTSKNKENGGTK 98 Query: 122 VEPTPNLKSSHGGLNEEKENLSVKKVGNSGHQE 24 P SS+G + EE E ++ NS HQE Sbjct: 99 ANPMTKGISSNGEVGEEHEKFTINSSPNSEHQE 131