BLASTX nr result
ID: Cocculus22_contig00023693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023693 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME85351.1| hypothetical protein MYCFIDRAFT_210209 [Pseudocer... 87 2e-15 gb|EME47364.1| hypothetical protein DOTSEDRAFT_69335 [Dothistrom... 70 4e-10 gb|ACM90103.1| candidate effector 14 [Venturia inaequalis] 57 2e-06 gb|EXJ91629.1| hypothetical protein A1O3_00179 [Capronia epimyce... 57 3e-06 gb|EXJ93633.1| hypothetical protein A1O1_02025 [Capronia coronat... 56 4e-06 gb|EON61764.1| hypothetical protein W97_00980 [Coniosporium apol... 56 4e-06 gb|EHY54466.1| hypothetical protein HMPREF1120_02634 [Exophiala ... 56 4e-06 gb|EMC96586.1| hypothetical protein BAUCODRAFT_148171 [Baudoinia... 56 6e-06 gb|EXJ69906.1| hypothetical protein A1O5_06979 [Cladophialophora... 55 8e-06 >gb|EME85351.1| hypothetical protein MYCFIDRAFT_210209 [Pseudocercospora fijiensis CIRAD86] Length = 301 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -3 Query: 428 GVSPYFTVCNYKSPGNYAGEYAANVPTPKGEPTAQWNYGGSS 303 GVSPYFTVCNYKSPGNYAGEYA NVP PKG P+ QWNYGGSS Sbjct: 260 GVSPYFTVCNYKSPGNYAGEYATNVPKPKGMPSVQWNYGGSS 301 >gb|EME47364.1| hypothetical protein DOTSEDRAFT_69335 [Dothistroma septosporum NZE10] Length = 280 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -3 Query: 428 GVSPYFTVCNYKSPGNYAGEYAANVPTPKGEPTAQWNYGGS 306 GV P FTVCNYK+PGNYAGEY ANV P G PTA WN G S Sbjct: 240 GVEPVFTVCNYKNPGNYAGEYGANVLQPLGHPTANWNTGSS 280 >gb|ACM90103.1| candidate effector 14 [Venturia inaequalis] Length = 334 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 425 VSPYFTVCNYKSPGNYAGEYAANVPTPKGEPTAQWN 318 VSP FTVCNYK+PGNY GE+A NV P G P+ WN Sbjct: 297 VSPDFTVCNYKTPGNYLGEFATNVLPPLGHPSIGWN 332 >gb|EXJ91629.1| hypothetical protein A1O3_00179 [Capronia epimyces CBS 606.96] Length = 316 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 428 GVSPYFTVCNYKSPGNYAGEYAANVPTPKGEPT 330 GVSPYFTVCNY PGN+ G+YAANV P G PT Sbjct: 281 GVSPYFTVCNYSPPGNFGGQYAANVLQPLGLPT 313 >gb|EXJ93633.1| hypothetical protein A1O1_02025 [Capronia coronata CBS 617.96] Length = 357 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -3 Query: 428 GVSPYFTVCNYKSPGNYAGEYAANVPTPKGEPT 330 GVSPYFTVCNY PGN+ G+YA NV P+G PT Sbjct: 322 GVSPYFTVCNYSPPGNFGGQYAVNVLQPQGLPT 354 >gb|EON61764.1| hypothetical protein W97_00980 [Coniosporium apollinis CBS 100218] Length = 319 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -3 Query: 425 VSPYFTVCNYKSPGNYAGEYAANVPTPKGEPTAQWNY 315 V+P+FTVCNYK PGN+ G+Y NV PT +WNY Sbjct: 283 VAPFFTVCNYKKPGNWGGQYGKNVGASLNHPTVRWNY 319 >gb|EHY54466.1| hypothetical protein HMPREF1120_02634 [Exophiala dermatitidis NIH/UT8656] Length = 372 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 428 GVSPYFTVCNYKSPGNYAGEYAANVPTPKGEPT 330 GVSPYFTVCNY GN+ G+YAANV PKG PT Sbjct: 337 GVSPYFTVCNYSPAGNFGGQYAANVLKPKGLPT 369 >gb|EMC96586.1| hypothetical protein BAUCODRAFT_148171 [Baudoinia compniacensis UAMH 10762] Length = 388 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -3 Query: 428 GVSPYFTVCNYKSPGNYAGEYAANVPTPKGEPTAQWNYGG 309 G FTVCNY PGN+A EY N+ TP PTA WN GG Sbjct: 339 GTDSSFTVCNYGPPGNFANEYGDNIGTPLNNPTASWNTGG 378 >gb|EXJ69906.1| hypothetical protein A1O5_06979 [Cladophialophora psammophila CBS 110553] Length = 279 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 425 VSPYFTVCNYKSPGNYAGEYAANVPTPKGEPT 330 VSPYFTVCNY PGN+ GEYAANV P G PT Sbjct: 245 VSPYFTVCNYSPPGNFGGEYAANVLQPGGLPT 276