BLASTX nr result
ID: Cocculus22_contig00023689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023689 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480200.1| PREDICTED: thioredoxin-like protein 4B-like ... 80 2e-13 ref|XP_006443650.1| hypothetical protein CICLE_v10022683mg [Citr... 80 2e-13 ref|XP_006443649.1| hypothetical protein CICLE_v10022683mg [Citr... 80 2e-13 ref|XP_007021811.1| MRNA splicing factor, thioredoxin-like U5 sn... 80 2e-13 ref|XP_004139665.1| PREDICTED: thioredoxin-like protein 4B-like ... 79 8e-13 ref|XP_007218478.1| hypothetical protein PRUPE_ppa012017mg [Prun... 77 2e-12 dbj|BAD43912.1| hypothetical protein [Arabidopsis thaliana] 77 2e-12 ref|NP_189117.2| mRNA splicing factor, thioredoxin-like U5 snRNP... 77 2e-12 ref|XP_006298736.1| hypothetical protein CARUB_v10014836mg [Caps... 77 3e-12 ref|XP_006352705.1| PREDICTED: thioredoxin-like protein 4B-like ... 76 5e-12 ref|XP_004242392.1| PREDICTED: thioredoxin-like protein 4B-like ... 76 5e-12 gb|ABR17861.1| unknown [Picea sitchensis] 76 5e-12 gb|ABK21102.1| unknown [Picea sitchensis] 76 5e-12 gb|EXB94060.1| Thioredoxin-like protein 4B [Morus notabilis] 75 7e-12 ref|XP_002885671.1| hypothetical protein ARALYDRAFT_479992 [Arab... 75 7e-12 ref|XP_002521122.1| Spliceosomal protein DIB1, putative [Ricinus... 75 7e-12 ref|XP_006845576.1| hypothetical protein AMTR_s00019p00194970 [A... 74 3e-11 ref|XP_004291693.1| PREDICTED: thioredoxin-like protein 4B-like ... 73 4e-11 ref|XP_002265712.1| PREDICTED: thioredoxin-like protein 4B isofo... 73 4e-11 gb|EYU46352.1| hypothetical protein MIMGU_mgv1a015627mg [Mimulus... 72 1e-10 >ref|XP_006480200.1| PREDICTED: thioredoxin-like protein 4B-like isoform X2 [Citrus sinensis] Length = 121 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL TLTKK+E+D +IRDTI+KVLVLRFGRA DA+CLQ+DD+LAKS+ Sbjct: 1 MSYLLTTLTKKKEIDTIIRDTIDKVLVLRFGRAMDALCLQLDDILAKSS 49 >ref|XP_006443650.1| hypothetical protein CICLE_v10022683mg [Citrus clementina] gi|568853088|ref|XP_006480199.1| PREDICTED: thioredoxin-like protein 4B-like isoform X1 [Citrus sinensis] gi|557545912|gb|ESR56890.1| hypothetical protein CICLE_v10022683mg [Citrus clementina] Length = 151 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL TLTKK+E+D +IRDTI+KVLVLRFGRA DA+CLQ+DD+LAKS+ Sbjct: 1 MSYLLTTLTKKKEIDTIIRDTIDKVLVLRFGRAMDALCLQLDDILAKSS 49 >ref|XP_006443649.1| hypothetical protein CICLE_v10022683mg [Citrus clementina] gi|557545911|gb|ESR56889.1| hypothetical protein CICLE_v10022683mg [Citrus clementina] Length = 151 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL TLTKK+E+D +IRDTI+KVLVLRFGRA DA+CLQ+DD+LAKS+ Sbjct: 1 MSYLLTTLTKKKEIDTIIRDTIDKVLVLRFGRAMDALCLQLDDILAKSS 49 >ref|XP_007021811.1| MRNA splicing factor, thioredoxin-like U5 snRNP [Theobroma cacao] gi|508721439|gb|EOY13336.1| MRNA splicing factor, thioredoxin-like U5 snRNP [Theobroma cacao] Length = 151 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL TLT+K EVD +IRDTI+KVLVLRFGRA+DAVCLQ+DD+LAK+A Sbjct: 1 MSYLLPTLTRKTEVDTIIRDTIDKVLVLRFGRAADAVCLQLDDILAKTA 49 >ref|XP_004139665.1| PREDICTED: thioredoxin-like protein 4B-like isoform 1 [Cucumis sativus] gi|449443802|ref|XP_004139666.1| PREDICTED: thioredoxin-like protein 4B-like isoform 2 [Cucumis sativus] gi|449475408|ref|XP_004154445.1| PREDICTED: thioredoxin-like protein 4B-like isoform 1 [Cucumis sativus] gi|449475410|ref|XP_004154446.1| PREDICTED: thioredoxin-like protein 4B-like isoform 2 [Cucumis sativus] Length = 151 Score = 78.6 bits (192), Expect = 8e-13 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLLRTLTKK EVD +IRDTI+KVL+LRFGR SD+VCL +DD+LAK A Sbjct: 1 MSYLLRTLTKKGEVDSLIRDTIDKVLILRFGRCSDSVCLLLDDILAKCA 49 >ref|XP_007218478.1| hypothetical protein PRUPE_ppa012017mg [Prunus persica] gi|462414940|gb|EMJ19677.1| hypothetical protein PRUPE_ppa012017mg [Prunus persica] Length = 187 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL TLTKKQEVD +IR TI+KVLVLRFGRASD+VCL +DD+L K+A Sbjct: 37 MSYLLTTLTKKQEVDSLIRSTIDKVLVLRFGRASDSVCLLLDDILDKTA 85 >dbj|BAD43912.1| hypothetical protein [Arabidopsis thaliana] Length = 151 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 MSYLL+TLT K+E+D VIRDTI++VLVLRFGR+SDAVCLQ D++LAKS Sbjct: 1 MSYLLKTLTTKEEIDRVIRDTIDEVLVLRFGRSSDAVCLQHDEILAKS 48 >ref|NP_189117.2| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis thaliana] gi|44917529|gb|AAS49089.1| At3g24730 [Arabidopsis thaliana] gi|332643419|gb|AEE76940.1| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis thaliana] Length = 159 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 MSYLL+TLT K+E+D VIRDTI++VLVLRFGR+SDAVCLQ D++LAKS Sbjct: 9 MSYLLKTLTTKEEIDRVIRDTIDEVLVLRFGRSSDAVCLQHDEILAKS 56 >ref|XP_006298736.1| hypothetical protein CARUB_v10014836mg [Capsella rubella] gi|482567445|gb|EOA31634.1| hypothetical protein CARUB_v10014836mg [Capsella rubella] Length = 152 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -3 Query: 144 SYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 SYLL+TLTKK+E+D +IRDTI++VLVLRFGR +DAVCL DD+LAKSA Sbjct: 3 SYLLKTLTKKEEIDRIIRDTIDEVLVLRFGRCTDAVCLHHDDILAKSA 50 >ref|XP_006352705.1| PREDICTED: thioredoxin-like protein 4B-like [Solanum tuberosum] Length = 151 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 M Y+LRTLTKK+EVD +IRDTI+KVLVLR GR+SD +CLQ+DD+L KS Sbjct: 1 MEYILRTLTKKEEVDSIIRDTIDKVLVLRLGRSSDPLCLQLDDILYKS 48 >ref|XP_004242392.1| PREDICTED: thioredoxin-like protein 4B-like [Solanum lycopersicum] Length = 151 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 M Y+LRTLTKK+EVD +IRDTI+KVLVLR GR+SD +CLQ+DD+L KS Sbjct: 1 MDYILRTLTKKEEVDSIIRDTIDKVLVLRLGRSSDPLCLQLDDILYKS 48 >gb|ABR17861.1| unknown [Picea sitchensis] Length = 151 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 MSYLL+TLT+KQ+VD +IRDT++KVLVLRFGRA+D VC+Q+D++LAK+ Sbjct: 1 MSYLLQTLTRKQDVDKLIRDTLDKVLVLRFGRATDVVCMQLDEILAKT 48 >gb|ABK21102.1| unknown [Picea sitchensis] Length = 151 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 MSYLL+TLT+KQ+VD +IRDT++KVLVLRFGRA+D VC+Q+D++LAK+ Sbjct: 1 MSYLLQTLTRKQDVDKLIRDTLDKVLVLRFGRATDVVCMQLDEILAKT 48 >gb|EXB94060.1| Thioredoxin-like protein 4B [Morus notabilis] Length = 152 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -3 Query: 147 MSYLL-RTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL RTLTKKQEVD +IRDTI+KVLVLRFGR+ D CL +DD+LAKSA Sbjct: 1 MSYLLLRTLTKKQEVDSIIRDTIDKVLVLRFGRSPDQACLLLDDVLAKSA 50 >ref|XP_002885671.1| hypothetical protein ARALYDRAFT_479992 [Arabidopsis lyrata subsp. lyrata] gi|297331511|gb|EFH61930.1| hypothetical protein ARALYDRAFT_479992 [Arabidopsis lyrata subsp. lyrata] Length = 151 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKS 4 MSYLL+TLTKK+E+D +IRDTI++VLVLRFGR SD VCLQ D++LAKS Sbjct: 1 MSYLLKTLTKKEEIDRIIRDTIDEVLVLRFGRFSDDVCLQHDEILAKS 48 >ref|XP_002521122.1| Spliceosomal protein DIB1, putative [Ricinus communis] gi|223539691|gb|EEF41273.1| Spliceosomal protein DIB1, putative [Ricinus communis] Length = 131 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MS LR LTKK+E+D +IRDTI+KVLVLRFGR+SDAVCL +DDLL+KSA Sbjct: 1 MSLELRRLTKKKEIDSLIRDTIDKVLVLRFGRSSDAVCLHLDDLLSKSA 49 >ref|XP_006845576.1| hypothetical protein AMTR_s00019p00194970 [Amborella trichopoda] gi|548848148|gb|ERN07251.1| hypothetical protein AMTR_s00019p00194970 [Amborella trichopoda] Length = 193 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/49 (69%), Positives = 44/49 (89%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MS+LL TL+KK++VD +IRDT++KVLVLRFGR SD CLQ+D++LAKSA Sbjct: 1 MSFLLNTLSKKRKVDSIIRDTLDKVLVLRFGRPSDPACLQLDNILAKSA 49 >ref|XP_004291693.1| PREDICTED: thioredoxin-like protein 4B-like [Fragaria vesca subsp. vesca] Length = 151 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MSYLL TLTKK+EVD +IR TI+KVLVLRFGRASD+ L +DD+LAKS+ Sbjct: 1 MSYLLTTLTKKEEVDSIIRSTIDKVLVLRFGRASDSTSLLLDDVLAKSS 49 >ref|XP_002265712.1| PREDICTED: thioredoxin-like protein 4B isoform 1 [Vitis vinifera] gi|359480353|ref|XP_003632435.1| PREDICTED: thioredoxin-like protein 4B isoform 2 [Vitis vinifera] gi|297744299|emb|CBI37269.3| unnamed protein product [Vitis vinifera] Length = 151 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/49 (67%), Positives = 45/49 (91%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 MS+L+ TL +K+EVD +IRDTI+KVLVLRFGR++D+VCL +DD+L+KSA Sbjct: 1 MSFLMTTLREKKEVDSIIRDTIDKVLVLRFGRSTDSVCLHLDDILSKSA 49 >gb|EYU46352.1| hypothetical protein MIMGU_mgv1a015627mg [Mimulus guttatus] Length = 151 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -3 Query: 147 MSYLLRTLTKKQEVDGVIRDTIEKVLVLRFGRASDAVCLQVDDLLAKSA 1 M YLL TL +K+EVD +IRDTI+KVLVLRFG +SD+VCLQ+DD+L KSA Sbjct: 1 MEYLLPTLREKREVDSLIRDTIDKVLVLRFGLSSDSVCLQLDDVLYKSA 49