BLASTX nr result
ID: Cocculus22_contig00023662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023662 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226928.1| hypothetical protein PRUPE_ppa015738mg, part... 59 7e-07 ref|XP_007226430.1| hypothetical protein PRUPE_ppa023949mg [Prun... 59 9e-07 ref|XP_007029298.1| UDP-glucosyltransferase, putative isoform 2 ... 57 3e-06 ref|XP_007029297.1| UDP-glucosyltransferase, putative isoform 1 ... 57 3e-06 >ref|XP_007226928.1| hypothetical protein PRUPE_ppa015738mg, partial [Prunus persica] gi|462423864|gb|EMJ28127.1| hypothetical protein PRUPE_ppa015738mg, partial [Prunus persica] Length = 501 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/46 (56%), Positives = 38/46 (82%) Frame = +3 Query: 3 GKGGEMMRRAAEIAGKIRSSVREDEDQRGSSVVALDDFLRFMMSKR 140 GKGGEM + AA I KIR+S+R+D++++GSSV A+DDF+ ++SKR Sbjct: 450 GKGGEMRKNAAVIKEKIRASIRDDDEEKGSSVKAMDDFVAVLLSKR 495 >ref|XP_007226430.1| hypothetical protein PRUPE_ppa023949mg [Prunus persica] gi|462423366|gb|EMJ27629.1| hypothetical protein PRUPE_ppa023949mg [Prunus persica] Length = 508 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/46 (56%), Positives = 38/46 (82%) Frame = +3 Query: 3 GKGGEMMRRAAEIAGKIRSSVREDEDQRGSSVVALDDFLRFMMSKR 140 GKGGEM + AA I KIR+S+R+D++++GSSV A+DDF+ ++SKR Sbjct: 450 GKGGEMRKNAAVIEEKIRASIRDDDEEKGSSVRAMDDFVAVLLSKR 495 >ref|XP_007029298.1| UDP-glucosyltransferase, putative isoform 2 [Theobroma cacao] gi|508717903|gb|EOY09800.1| UDP-glucosyltransferase, putative isoform 2 [Theobroma cacao] Length = 424 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 38/46 (82%) Frame = +3 Query: 3 GKGGEMMRRAAEIAGKIRSSVREDEDQRGSSVVALDDFLRFMMSKR 140 GKGGEM ++A EIA KIR++V E+ +++GSS+ ALDDF+ +++KR Sbjct: 360 GKGGEMRKKAVEIAEKIRAAVTEEGERKGSSITALDDFISAVLTKR 405 >ref|XP_007029297.1| UDP-glucosyltransferase, putative isoform 1 [Theobroma cacao] gi|508717902|gb|EOY09799.1| UDP-glucosyltransferase, putative isoform 1 [Theobroma cacao] Length = 510 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 38/46 (82%) Frame = +3 Query: 3 GKGGEMMRRAAEIAGKIRSSVREDEDQRGSSVVALDDFLRFMMSKR 140 GKGGEM ++A EIA KIR++V E+ +++GSS+ ALDDF+ +++KR Sbjct: 462 GKGGEMRKKAVEIAEKIRAAVTEEGERKGSSITALDDFISAVLTKR 507