BLASTX nr result
ID: Cocculus22_contig00023570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023570 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKJ70768.1| hypothetical protein FPSE_09061 [Fusarium pseudog... 103 2e-20 gb|EMT62200.1| hypothetical protein FOC4_g10015287 [Fusarium oxy... 84 2e-14 gb|EGU80800.1| hypothetical protein FOXB_08667 [Fusarium oxyspor... 84 2e-14 gb|EWG37725.1| hypothetical protein FVEG_14797 [Fusarium vertici... 82 8e-14 emb|CCT62181.1| uncharacterized protein FFUJ_01292 [Fusarium fuj... 82 8e-14 >gb|EKJ70768.1| hypothetical protein FPSE_09061 [Fusarium pseudograminearum CS3096] gi|558856300|gb|ESU06383.1| hypothetical protein FGSG_11900 [Fusarium graminearum PH-1] gi|596554790|gb|EYB33879.1| hypothetical protein FG05_11900 [Fusarium graminearum] Length = 72 Score = 103 bits (258), Expect = 2e-20 Identities = 52/55 (94%), Positives = 52/55 (94%) Frame = -3 Query: 166 MDSGAPQTGAATGNVSGRRRSSGFMPAFASLSEQKRGSQDSATRRASMSDQQPKS 2 MDSGAPQTGAATGNVSGRRRSSGFMPAFA LSEQKRGSQDSA RRASMSDQ PKS Sbjct: 1 MDSGAPQTGAATGNVSGRRRSSGFMPAFAGLSEQKRGSQDSAARRASMSDQAPKS 55 >gb|EMT62200.1| hypothetical protein FOC4_g10015287 [Fusarium oxysporum f. sp. cubense race 4] gi|477507478|gb|ENH60772.1| hypothetical protein FOC1_g10015574 [Fusarium oxysporum f. sp. cubense race 1] gi|587671918|gb|EWY94259.1| hypothetical protein FOYG_07079 [Fusarium oxysporum FOSC 3-a] gi|587703847|gb|EWZ50452.1| hypothetical protein FOZG_00960 [Fusarium oxysporum Fo47] gi|587720748|gb|EWZ92085.1| hypothetical protein FOWG_07370 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587755631|gb|EXA53347.1| hypothetical protein FOVG_01227 [Fusarium oxysporum f. sp. pisi HDV247] gi|590045824|gb|EXK47682.1| hypothetical protein FOMG_00959 [Fusarium oxysporum f. sp. melonis 26406] gi|590062394|gb|EXK89918.1| hypothetical protein FOQG_07389 [Fusarium oxysporum f. sp. raphani 54005] gi|591414245|gb|EXL49382.1| hypothetical protein FOCG_09759 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591479800|gb|EXM10860.1| hypothetical protein FOIG_00768 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591498824|gb|EXM28262.1| hypothetical protein FOTG_05639 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 71 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/54 (83%), Positives = 46/54 (85%) Frame = -3 Query: 166 MDSGAPQTGAATGNVSGRRRSSGFMPAFASLSEQKRGSQDSATRRASMSDQQPK 5 MDSGAPQT A TGNVSGRRRSSGFMPAFASLSEQKR +A RRASMSDQQ K Sbjct: 1 MDSGAPQT-APTGNVSGRRRSSGFMPAFASLSEQKRAGDANAARRASMSDQQAK 53 >gb|EGU80800.1| hypothetical protein FOXB_08667 [Fusarium oxysporum Fo5176] gi|591451242|gb|EXL83566.1| hypothetical protein FOPG_03699 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 71 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/54 (83%), Positives = 46/54 (85%) Frame = -3 Query: 166 MDSGAPQTGAATGNVSGRRRSSGFMPAFASLSEQKRGSQDSATRRASMSDQQPK 5 MDSGAPQT A TGNVSGRRRSSGFMPAFASLSEQKR +A RRASMSDQQ K Sbjct: 1 MDSGAPQT-APTGNVSGRRRSSGFMPAFASLSEQKRAGDANAARRASMSDQQAK 53 >gb|EWG37725.1| hypothetical protein FVEG_14797 [Fusarium verticillioides 7600] Length = 71 Score = 82.0 bits (201), Expect = 8e-14 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = -3 Query: 166 MDSGAPQTGAATGNVSGRRRSSGFMPAFASLSEQKRGSQDSATRRASMSDQQPK 5 MDS APQT A TGNVSGRRRSSGFMPAFASLSEQKR +A RRASMSDQQ K Sbjct: 1 MDSSAPQT-APTGNVSGRRRSSGFMPAFASLSEQKRAGDANAARRASMSDQQAK 53 >emb|CCT62181.1| uncharacterized protein FFUJ_01292 [Fusarium fujikuroi IMI 58289] Length = 71 Score = 82.0 bits (201), Expect = 8e-14 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = -3 Query: 166 MDSGAPQTGAATGNVSGRRRSSGFMPAFASLSEQKRGSQDSATRRASMSDQQPK 5 MDSGAPQT A TGNVS RRRSSGFMPAFASLSEQKR +A RRASMSDQQ K Sbjct: 1 MDSGAPQT-APTGNVSSRRRSSGFMPAFASLSEQKRAGDANAARRASMSDQQAK 53