BLASTX nr result
ID: Cocculus22_contig00023095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00023095 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528155.1| UDP-glucosyltransferase, putative [Ricinus c... 46 8e-07 dbj|BAF96585.1| glucosyltransferase homolog [Lycium chinense] gi... 57 4e-06 dbj|BAB60721.1| glucosyltransferase [Nicotiana tabacum] 56 5e-06 ref|XP_002528153.1| hypothetical protein RCOM_1196290 [Ricinus c... 43 9e-06 >ref|XP_002528155.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223532453|gb|EEF34246.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 485 Score = 46.2 bits (108), Expect(2) = 8e-07 Identities = 18/40 (45%), Positives = 30/40 (75%) Frame = +1 Query: 1 NSVSLAVLIVDMFTTNFIDVANDLALPCYVFYTSGVAMLG 120 N V ++ L VDMF+T+ +DVA++L +PCY+++ S + LG Sbjct: 111 NEVQVSGLFVDMFSTSMVDVADELNIPCYLYFASPASFLG 150 Score = 32.3 bits (72), Expect(2) = 8e-07 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +2 Query: 125 LHLPILDSQIGTDFID 172 LHLPILD+Q+ TDFID Sbjct: 153 LHLPILDTQLATDFID 168 >dbj|BAF96585.1| glucosyltransferase homolog [Lycium chinense] gi|209954697|dbj|BAG80539.1| UDP-glucose:glucosyltransferase [Lycium barbarum] Length = 465 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 1 NSVSLAVLIVDMFTTNFIDVANDLALPCYVFYTSGVAMLGL 123 +SV LA ++DMF T IDVAND +P Y+FYTSG AMLGL Sbjct: 98 SSVKLAGFVIDMFCTAMIDVANDFGVPSYLFYTSGAAMLGL 138 >dbj|BAB60721.1| glucosyltransferase [Nicotiana tabacum] Length = 479 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +1 Query: 1 NSVSLAVLIVDMFTTNFIDVANDLALPCYVFYTSGVAMLGL 123 NSV LA ++DMF T IDVAN+ +P YVFYTS AMLGL Sbjct: 110 NSVKLAGFVIDMFCTAMIDVANEFGIPSYVFYTSSAAMLGL 150 >ref|XP_002528153.1| hypothetical protein RCOM_1196290 [Ricinus communis] gi|223532451|gb|EEF34244.1| hypothetical protein RCOM_1196290 [Ricinus communis] Length = 103 Score = 43.1 bits (100), Expect(2) = 9e-06 Identities = 18/34 (52%), Positives = 25/34 (73%) Frame = +1 Query: 22 LIVDMFTTNFIDVANDLALPCYVFYTSGVAMLGL 123 L VDMF T ID AN+L +PCY++++S + LGL Sbjct: 39 LFVDMFCTFMIDAANELHIPCYLYFSSPASFLGL 72 Score = 32.0 bits (71), Expect(2) = 9e-06 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +2 Query: 125 LHLPILDSQIGTDFID 172 LHLP+LD+Q+ TDFID Sbjct: 74 LHLPVLDTQLATDFID 89