BLASTX nr result
ID: Cocculus22_contig00022993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00022993 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003854675.1| hypothetical protein MYCGRDRAFT_79738 [Zymos... 64 3e-08 gb|EME41668.1| hypothetical protein DOTSEDRAFT_46600 [Dothistrom... 63 4e-08 gb|EMC93079.1| hypothetical protein BAUCODRAFT_77338 [Baudoinia ... 56 6e-06 >ref|XP_003854675.1| hypothetical protein MYCGRDRAFT_79738 [Zymoseptoria tritici IPO323] gi|339474558|gb|EGP89651.1| hypothetical protein MYCGRDRAFT_79738 [Zymoseptoria tritici IPO323] Length = 69 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 5/59 (8%) Frame = -1 Query: 334 PEPERQGESQI-KQTSNPNPQ----GSDKSGEASKEQLSNLSSNPGGPLDKEAEKKTSK 173 PEPERQ +SQ Q S PN Q G K E SKE L L SNPGGPLD+EA+KKT+K Sbjct: 11 PEPERQSDSQTGTQASQPNDQNAGPGGAKPAEQSKETLEKLGSNPGGPLDEEAKKKTAK 69 >gb|EME41668.1| hypothetical protein DOTSEDRAFT_46600 [Dothistroma septosporum NZE10] Length = 70 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = -1 Query: 334 PEPERQGESQIK----QTSNPNPQGSDKSGEASKEQLSNLSSNPGGPLDKEAEKKTSK 173 P+P++Q ESQI+ +N + S + EASK+QL NL SNPGGPLDK AE+KT+K Sbjct: 11 PDPDQQKESQIRAPATDVNNQGQEASQGAAEASKDQLKNLGSNPGGPLDKAAEEKTAK 68 >gb|EMC93079.1| hypothetical protein BAUCODRAFT_77338 [Baudoinia compniacensis UAMH 10762] Length = 73 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -1 Query: 334 PEPERQGESQIKQ--TSNPNPQGSDKSGEASKEQLSNLSSNPGGPLDKEAEKKTSKN 170 P+PERQ +SQ+ + SNPN Q + + + +KE L +L SNP GPL+ AE+KT K+ Sbjct: 11 PDPERQSKSQLHEPTASNPNDQAKEVTQDQNKEALKSLESNPKGPLEDFAEEKTKKD 67