BLASTX nr result
ID: Cocculus22_contig00022510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00022510 (717 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435930.1| hypothetical protein CICLE_v10031719mg [Citr... 70 7e-10 >ref|XP_006435930.1| hypothetical protein CICLE_v10031719mg [Citrus clementina] gi|557538126|gb|ESR49170.1| hypothetical protein CICLE_v10031719mg [Citrus clementina] Length = 372 Score = 70.1 bits (170), Expect = 7e-10 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = -1 Query: 540 MEVNGVANNFLPN*KQAIVSCLCKHLSLDPVMKCVKFADTFPVESVASEGVIKGLNEDLA 361 M NG N P KQ IVS LCKHLSLD VMK ++FA++FP +S A V+ LNE+LA Sbjct: 1 MAANGSKN---PTRKQLIVSILCKHLSLDHVMKWIEFAESFPADSKACFDVLIKLNEELA 57 Query: 360 QKSVLLG-GLR 331 KSVLLG GLR Sbjct: 58 TKSVLLGNGLR 68