BLASTX nr result
ID: Cocculus22_contig00022020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00022020 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843653.1| hypothetical protein AMTR_s00007p00177030 [A... 61 1e-07 >ref|XP_006843653.1| hypothetical protein AMTR_s00007p00177030 [Amborella trichopoda] gi|548846021|gb|ERN05328.1| hypothetical protein AMTR_s00007p00177030 [Amborella trichopoda] Length = 263 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 212 VTTKWETFESGVGSLSAPPRMLPTKITKDWQLFD 111 VTT+WETFE+GVGSLSAP PTKITKDW+LFD Sbjct: 230 VTTQWETFETGVGSLSAPQPSSPTKITKDWELFD 263