BLASTX nr result
ID: Cocculus22_contig00021842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00021842 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19304.1| hypothetical protein MIMGU_mgv1a012341mg [Mimulus... 87 2e-15 ref|XP_006382189.1| tRNA (guanine-N(7)-)-methyltransferase famil... 86 4e-15 ref|XP_003603585.1| tRNA (guanine-N(7)-)-methyltransferase [Medi... 86 4e-15 ref|XP_007223703.1| hypothetical protein PRUPE_ppa010368mg [Prun... 85 9e-15 ref|XP_006371815.1| tRNA (guanine-N(7)-)-methyltransferase famil... 85 9e-15 ref|XP_004965088.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 85 1e-14 ref|XP_004501204.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 85 1e-14 ref|XP_006483612.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 84 2e-14 ref|XP_006450120.1| hypothetical protein CICLE_v10009277mg [Citr... 84 2e-14 gb|AFK39576.1| unknown [Lotus japonicus] 84 2e-14 gb|EXC32779.1| tRNA (guanine-N(7)-)-methyltransferase [Morus not... 84 3e-14 ref|XP_007035706.1| TRNA (guanine-N-7) methyltransferase isoform... 84 3e-14 ref|XP_002453241.1| hypothetical protein SORBIDRAFT_04g002310 [S... 84 3e-14 ref|NP_001146900.1| tRNA (guanine-N(7)-)-methyltransferase [Zea ... 84 3e-14 ref|XP_004138787.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 83 4e-14 gb|EMT08155.1| tRNA (guanine-N(7)-)-methyltransferase [Aegilops ... 82 6e-14 ref|NP_197866.1| tRNA (guanine-N(7)-)-methyltransferase [Arabido... 82 6e-14 gb|ADE77375.1| unknown [Picea sitchensis] 82 6e-14 ref|XP_002874226.1| methyltransferase [Arabidopsis lyrata subsp.... 82 8e-14 dbj|BAK08184.1| predicted protein [Hordeum vulgare subsp. vulgare] 82 1e-13 >gb|EYU19304.1| hypothetical protein MIMGU_mgv1a012341mg [Mimulus guttatus] Length = 253 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/67 (58%), Positives = 47/67 (70%) Frame = +2 Query: 182 MSAENKKSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSD 361 M + +N S +TGLPRKRFYRARAHSNPLSDSHFPVP P+ FD HYP FF + Sbjct: 1 MLEQESIANHTHSKTTGLPRKRFYRARAHSNPLSDSHFPVPASPAQFDCALHYPQFFPPN 60 Query: 362 RTNNEEE 382 +TN ++ Sbjct: 61 KTNGSQK 67 >ref|XP_006382189.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] gi|550337344|gb|ERP59986.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] Length = 252 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = +2 Query: 200 KSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSS 358 ++N S STGLPRKRFYRARAHSNPLSDSHFPVPI PS D HYP FFSS Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQFFSS 57 >ref|XP_003603585.1| tRNA (guanine-N(7)-)-methyltransferase [Medicago truncatula] gi|355492633|gb|AES73836.1| tRNA (guanine-N(7)-)-methyltransferase [Medicago truncatula] gi|388511605|gb|AFK43864.1| unknown [Medicago truncatula] Length = 255 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/57 (71%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 206 NVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTNN 373 N FS STGLPRKRFYRARAHSNPLSDSHFPVP+ PS D HYP FF SSD+ ++ Sbjct: 7 NSTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPLSPSHVDYSLHYPQFFPSSDKADS 63 >ref|XP_007223703.1| hypothetical protein PRUPE_ppa010368mg [Prunus persica] gi|462420639|gb|EMJ24902.1| hypothetical protein PRUPE_ppa010368mg [Prunus persica] Length = 252 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/60 (68%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +2 Query: 197 KKSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTNN 373 K++N FS STGLPRKRFYRARAHSNPLSDSHFPVPI P D HYP F SSD+ ++ Sbjct: 4 KEANPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPGHVDYSLHYPQHFPSSDQVDS 63 >ref|XP_006371815.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] gi|550317988|gb|ERP49612.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] Length = 252 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = +2 Query: 200 KSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFS 355 ++N S STGLPRKRFYRARAHSNPLSDSHFPVPI PS D HYP FFS Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDFSLHYPQFFS 56 >ref|XP_004965088.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Setaria italica] Length = 263 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +2 Query: 233 LPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSDRTNNEE 379 LPRKRFYRARAHSNPLSDSHFPVP+ P +FDL +HYP +F +D+ + EE Sbjct: 23 LPRKRFYRARAHSNPLSDSHFPVPVSPDEFDLSEHYPRYFPADKGSGEE 71 >ref|XP_004501204.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Cicer arietinum] Length = 255 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/60 (68%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +2 Query: 206 NVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTNNEEE 382 N S STGLPRKRFYRARAHSNPLSDSHFPVPI PS D HYP FF SSD++++ + Sbjct: 7 NPTHSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQFFPSSDQSDSSRK 66 >ref|XP_006483612.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X1 [Citrus sinensis] gi|568860200|ref|XP_006483613.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X2 [Citrus sinensis] gi|568860202|ref|XP_006483614.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X3 [Citrus sinensis] Length = 252 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/59 (67%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = +2 Query: 197 KKSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTN 370 +++N S STGLPRKRFYRARAHSNPLSDSHFPVPI PS D HYP+FF +D+ N Sbjct: 4 QETNPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPHFFPPADQVN 62 >ref|XP_006450120.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|567916230|ref|XP_006450121.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|567916232|ref|XP_006450122.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553346|gb|ESR63360.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553347|gb|ESR63361.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553348|gb|ESR63362.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] Length = 252 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/59 (67%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = +2 Query: 197 KKSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTN 370 +++N S STGLPRKRFYRARAHSNPLSDSHFPVPI PS D HYP+FF +D+ N Sbjct: 4 QETNPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPHFFPPADQVN 62 >gb|AFK39576.1| unknown [Lotus japonicus] Length = 255 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = +2 Query: 206 NVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTNNEEE 382 N FS STGLPRKRFYRARAHSNPLSDSHFPVPI P D HYP F SSDR ++ + Sbjct: 7 NPTFSESTGLPRKRFYRARAHSNPLSDSHFPVPISPRHVDYSLHYPQLFPSSDRADSSRK 66 >gb|EXC32779.1| tRNA (guanine-N(7)-)-methyltransferase [Morus notabilis] Length = 252 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/62 (62%), Positives = 47/62 (75%), Gaps = 1/62 (1%) Frame = +2 Query: 200 KSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTNNE 376 ++N S STGLPRKRFYRARAHSNPLSDSHFP+PI P D HYP FF S D+T++ Sbjct: 5 EANPTLSKSTGLPRKRFYRARAHSNPLSDSHFPIPISPHHVDYSLHYPQFFPSPDQTDSS 64 Query: 377 EE 382 ++ Sbjct: 65 KK 66 >ref|XP_007035706.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|590661559|ref|XP_007035707.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|508714735|gb|EOY06632.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|508714736|gb|EOY06633.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] Length = 251 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/61 (63%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = +2 Query: 200 KSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFF-SSDRTNNE 376 K+N + STGLPRKRFYRARAHSNPLSDSHFP+P+ PS D HYP F SSD+ N Sbjct: 5 KANPTINKSTGLPRKRFYRARAHSNPLSDSHFPIPLSPSHVDYSLHYPQLFPSSDQINGS 64 Query: 377 E 379 + Sbjct: 65 K 65 >ref|XP_002453241.1| hypothetical protein SORBIDRAFT_04g002310 [Sorghum bicolor] gi|241933072|gb|EES06217.1| hypothetical protein SORBIDRAFT_04g002310 [Sorghum bicolor] Length = 254 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +2 Query: 233 LPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSDRTNNEEETS 388 LPRKRFYRARAHSNPLSDSHFPVPI P + DL QHYP +F +D+ ++ EE + Sbjct: 12 LPRKRFYRARAHSNPLSDSHFPVPISPKEVDLSQHYPRYFPADKGSDGEEAA 63 >ref|NP_001146900.1| tRNA (guanine-N(7)-)-methyltransferase [Zea mays] gi|238055382|sp|B6SHG7.1|TRMB_MAIZE RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA (guanine(46)-N(7))-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase gi|195604940|gb|ACG24300.1| tRNA (guanine-N(1)-)-methyltransferase [Zea mays] gi|224028353|gb|ACN33252.1| unknown [Zea mays] gi|413926730|gb|AFW66662.1| tRNA (guanine-N(7)-)-methyltransferase isoform 1 [Zea mays] gi|413926731|gb|AFW66663.1| tRNA (guanine-N(7)-)-methyltransferase isoform 2 [Zea mays] gi|413926732|gb|AFW66664.1| tRNA (guanine-N(7)-)-methyltransferase isoform 3 [Zea mays] Length = 255 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +2 Query: 233 LPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSDRTNNEEETS 388 LPRKRFYRARAHSNPLSDSHFPVPI P + DL QHYP +F +D+ ++ EE + Sbjct: 13 LPRKRFYRARAHSNPLSDSHFPVPISPEEVDLSQHYPRYFPADKGSDGEEAA 64 >ref|XP_004138787.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Cucumis sativus] gi|449499318|ref|XP_004160784.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Cucumis sativus] Length = 252 Score = 83.2 bits (204), Expect = 4e-14 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +2 Query: 200 KSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSD 361 ++N S STGLPRKRFYRARAHSNPLSDSHFP+PI PS+ D HYP F S+ Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPIPISPSEVDYSLHYPQLFPSN 58 >gb|EMT08155.1| tRNA (guanine-N(7)-)-methyltransferase [Aegilops tauschii] Length = 226 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +2 Query: 233 LPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSDRTNNE 376 LPRKRFYRARAHSNPLSDSHFP+PI P D DL QHYP +F +D+ +E Sbjct: 18 LPRKRFYRARAHSNPLSDSHFPIPIAPDDVDLSQHYPRYFPADKGEHE 65 >ref|NP_197866.1| tRNA (guanine-N(7)-)-methyltransferase [Arabidopsis thaliana] gi|32171847|sp|Q8GXB7.1|TRMB_ARATH RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA (guanine(46)-N(7))-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase gi|26451686|dbj|BAC42938.1| putative methyltransferase [Arabidopsis thaliana] gi|29824305|gb|AAP04113.1| putative methyltransferase [Arabidopsis thaliana] gi|332005985|gb|AED93368.1| tRNA (guanine-N(7)-)-methyltransferase [Arabidopsis thaliana] Length = 251 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +2 Query: 191 ENKKSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSD 361 +N+ FS STGLPRKRFYRARAHSNPLSDSHFP+PI P+ D H+P F +D Sbjct: 2 DNETKATTFSKSTGLPRKRFYRARAHSNPLSDSHFPIPISPAHVDYSLHFPKFVEAD 58 >gb|ADE77375.1| unknown [Picea sitchensis] Length = 315 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/58 (60%), Positives = 43/58 (74%) Frame = +2 Query: 218 SNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSDRTNNEEETSN 391 + S LPRKRFYRARAHSNPLSDSHFPVP+ P++FD +H+P FF T+N + N Sbjct: 8 TGSAKLPRKRFYRARAHSNPLSDSHFPVPVSPAEFDYSEHFPAFFDRSPTSNPNDKDN 65 >ref|XP_002874226.1| methyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297320063|gb|EFH50485.1| methyltransferase [Arabidopsis lyrata subsp. lyrata] Length = 251 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/60 (63%), Positives = 44/60 (73%) Frame = +2 Query: 182 MSAENKKSNVKFSNSTGLPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSD 361 M +E K + FS STGLPRKRFYRARAHSNPLSDSHFP+PI P+ D H+P F +D Sbjct: 1 MDSETKPTT--FSKSTGLPRKRFYRARAHSNPLSDSHFPIPISPAHVDFSLHFPKFVEAD 58 >dbj|BAK08184.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 264 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 233 LPRKRFYRARAHSNPLSDSHFPVPIKPSDFDLFQHYPNFFSSDRTNN 373 LPRKRFYRARAHSNPLSDSHFP+PI P D DL QHYP +F +D+ + Sbjct: 18 LPRKRFYRARAHSNPLSDSHFPIPISPDDVDLSQHYPRYFPADKAEH 64