BLASTX nr result
ID: Cocculus22_contig00021631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00021631 (624 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242481.1| PREDICTED: uncharacterized protein LOC101245... 84 4e-14 ref|XP_002276395.2| PREDICTED: uncharacterized protein LOC100244... 79 8e-13 emb|CAN65086.1| hypothetical protein VITISV_035031 [Vitis vinifera] 79 8e-13 ref|XP_006350882.1| PREDICTED: uncharacterized protein LOC102603... 77 4e-12 gb|EXC19536.1| hypothetical protein L484_010667 [Morus notabilis] 70 5e-10 ref|XP_007048777.1| Myb-like HTH transcriptional regulator famil... 66 1e-08 ref|XP_007046820.1| Myb-like HTH transcriptional regulator famil... 66 1e-08 ref|XP_006857070.1| hypothetical protein AMTR_s00065p00074950, p... 65 2e-08 gb|EXC19537.1| hypothetical protein L484_010668 [Morus notabilis] 63 8e-08 ref|XP_007146880.1| hypothetical protein PHAVU_006G078200g [Phas... 61 2e-07 ref|XP_004166350.1| PREDICTED: uncharacterized LOC101205896 [Cuc... 60 5e-07 ref|XP_004140028.1| PREDICTED: uncharacterized protein LOC101205... 60 5e-07 ref|XP_002319963.2| hypothetical protein POPTR_0013s15060g [Popu... 60 7e-07 ref|XP_006376552.1| hypothetical protein POPTR_0013s15060g [Popu... 60 7e-07 ref|XP_007207092.1| hypothetical protein PRUPE_ppa023474mg [Prun... 59 2e-06 ref|XP_002519314.1| telomeric repeat binding protein, putative [... 59 2e-06 ref|XP_004500362.1| PREDICTED: uncharacterized protein LOC101503... 58 3e-06 ref|XP_006591259.1| PREDICTED: uncharacterized protein LOC100819... 57 6e-06 ref|XP_002518779.1| hypothetical protein RCOM_0813700 [Ricinus c... 57 6e-06 ref|XP_006486662.1| PREDICTED: uncharacterized protein LOC102608... 56 8e-06 >ref|XP_004242481.1| PREDICTED: uncharacterized protein LOC101245372 [Solanum lycopersicum] Length = 471 Score = 83.6 bits (205), Expect = 4e-14 Identities = 40/72 (55%), Positives = 53/72 (73%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 +D +I+ WILEF+ RQ +DD V NG I VLPLP L K +L+RKI SE+S G ++EK Sbjct: 7 IDTDISHWILEFILRQPLDDSVLNGFIHVLPLPNDKPNLKKALLIRKIESEISNGSVNEK 66 Query: 37 ILDSLEMIEEID 2 ILD LE+IEE++ Sbjct: 67 ILDFLELIEELN 78 >ref|XP_002276395.2| PREDICTED: uncharacterized protein LOC100244907 [Vitis vinifera] gi|297745761|emb|CBI15817.3| unnamed protein product [Vitis vinifera] Length = 479 Score = 79.3 bits (194), Expect = 8e-13 Identities = 39/72 (54%), Positives = 53/72 (73%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +++RWILEF+ R+ I D + LIS+LPL + R+ K VLLRKI SE+S G +SE Sbjct: 1 MDEDVSRWILEFMIRKPIGDSLVRRLISILPLSNSHPRMKKTVLLRKIESEISDGSVSET 60 Query: 37 ILDSLEMIEEID 2 IL+ LE+IEE+D Sbjct: 61 ILELLEIIEELD 72 >emb|CAN65086.1| hypothetical protein VITISV_035031 [Vitis vinifera] Length = 444 Score = 79.3 bits (194), Expect = 8e-13 Identities = 39/72 (54%), Positives = 53/72 (73%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +++RWILEF+ R+ I D + LIS+LPL + R+ K VLLRKI SE+S G +SE Sbjct: 1 MDEDVSRWILEFMIRKPIGDSLVRRLISILPLSNSHPRMKKTVLLRKIESEISDGSVSET 60 Query: 37 ILDSLEMIEEID 2 IL+ LE+IEE+D Sbjct: 61 ILELLEIIEELD 72 >ref|XP_006350882.1| PREDICTED: uncharacterized protein LOC102603861 [Solanum tuberosum] Length = 468 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/72 (51%), Positives = 52/72 (72%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 +D +I+ WILEF+ RQ +DD + N LI VLPL L K +L+RKI SE+S G ++EK Sbjct: 7 IDTDISHWILEFILRQPLDDGILNDLIHVLPLSNDKPNLKKALLIRKIESEISNGSVNEK 66 Query: 37 ILDSLEMIEEID 2 IL+ LE+IEE++ Sbjct: 67 ILEFLELIEELN 78 >gb|EXC19536.1| hypothetical protein L484_010667 [Morus notabilis] Length = 587 Score = 70.1 bits (170), Expect = 5e-10 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = -3 Query: 214 DPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEKI 35 D ++RW+LEFL R S D+ ++VLP+P D RL K VLLR I EVS GL++ Sbjct: 5 DKTLSRWLLEFLLRNSDDEPFAKRALAVLPIPDDDPRLKKTVLLRTIEYEVSEGLVTSTA 64 Query: 34 LDSLEMIEEID 2 L++LE+IEE+D Sbjct: 65 LENLELIEELD 75 >ref|XP_007048777.1| Myb-like HTH transcriptional regulator family protein [Theobroma cacao] gi|508701038|gb|EOX92934.1| Myb-like HTH transcriptional regulator family protein [Theobroma cacao] Length = 213 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/72 (48%), Positives = 44/72 (61%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD EI WI+EFL R+S D+ + LI P RL K +LL I +E+ AG +SE+ Sbjct: 1 MDREICGWIIEFLVRESTDEMLVKKLIQAFPPLNGKPRLKKTLLLHSIRTEILAGNVSER 60 Query: 37 ILDSLEMIEEID 2 ILD LE IE ID Sbjct: 61 ILDHLERIERID 72 >ref|XP_007046820.1| Myb-like HTH transcriptional regulator family protein [Theobroma cacao] gi|508699081|gb|EOX90977.1| Myb-like HTH transcriptional regulator family protein [Theobroma cacao] Length = 253 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/72 (48%), Positives = 45/72 (62%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD EI WI+EFL R+S D+ + LI V P R+ K +LL I +E+ AG +SE+ Sbjct: 5 MDREICGWIIEFLVRESTDEMLVKKLIQVFPPLNGRPRVKKTLLLHSIRTEILAGNVSER 64 Query: 37 ILDSLEMIEEID 2 ILD LE IE ID Sbjct: 65 ILDHLERIERID 76 >ref|XP_006857070.1| hypothetical protein AMTR_s00065p00074950, partial [Amborella trichopoda] gi|548861153|gb|ERN18537.1| hypothetical protein AMTR_s00065p00074950, partial [Amborella trichopoda] Length = 576 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/63 (52%), Positives = 47/63 (74%) Frame = -3 Query: 190 LEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEKILDSLEMIE 11 +EFL Q ++D V N LI VLPL + L K +LL++ISS++S GLI+E+ILDSLEM+ Sbjct: 1 MEFLLDQRVEDWVINSLICVLPLSDRNLFLKKLILLQRISSDMSKGLITERILDSLEMMS 60 Query: 10 EID 2 E++ Sbjct: 61 ELE 63 >gb|EXC19537.1| hypothetical protein L484_010668 [Morus notabilis] Length = 511 Score = 62.8 bits (151), Expect = 8e-08 Identities = 35/71 (49%), Positives = 46/71 (64%) Frame = -3 Query: 214 DPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEKI 35 D +R +LEFL R S D+ + ++VLP P D RL K VLLR I EVS GL++E Sbjct: 5 DKTHSRRLLEFLLRNSDDEPLAKRALAVLPSPHDDPRLKKTVLLRTIEYEVSEGLVTETA 64 Query: 34 LDSLEMIEEID 2 L +LE+IEE+D Sbjct: 65 LGNLELIEELD 75 >ref|XP_007146880.1| hypothetical protein PHAVU_006G078200g [Phaseolus vulgaris] gi|561020103|gb|ESW18874.1| hypothetical protein PHAVU_006G078200g [Phaseolus vulgaris] Length = 473 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/72 (41%), Positives = 46/72 (63%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +I+RW++EFL R S+ D + + VLPL AD RL K +LLR + + + +SE Sbjct: 1 MDSDISRWVMEFLLRSSVPDSLIQKTLIVLPLSGADSRLKKTLLLRILRTLLLKASLSET 60 Query: 37 ILDSLEMIEEID 2 L LE++E++D Sbjct: 61 ALQILELLEDLD 72 >ref|XP_004166350.1| PREDICTED: uncharacterized LOC101205896 [Cucumis sativus] Length = 559 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/72 (38%), Positives = 46/72 (63%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +I RWI+EF+ R +D + +++++P+ D RL K VLL I SE+ + +EK Sbjct: 1 MDGDICRWIIEFILRTPMDRHLQKKVLAIVPISDKDFRLTKTVLLGSIESEIFEAVATEK 60 Query: 37 ILDSLEMIEEID 2 +L + E IE++D Sbjct: 61 LLQTFECIEQLD 72 >ref|XP_004140028.1| PREDICTED: uncharacterized protein LOC101205896 [Cucumis sativus] Length = 559 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/72 (38%), Positives = 46/72 (63%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +I RWI+EF+ R +D + +++++P+ D RL K VLL I SE+ + +EK Sbjct: 1 MDGDICRWIIEFILRTPMDRHLQKKVLAIVPISDKDFRLTKTVLLGSIESEIFEAVATEK 60 Query: 37 ILDSLEMIEEID 2 +L + E IE++D Sbjct: 61 LLQTFECIEQLD 72 >ref|XP_002319963.2| hypothetical protein POPTR_0013s15060g [Populus trichocarpa] gi|550325885|gb|EEE95886.2| hypothetical protein POPTR_0013s15060g [Populus trichocarpa] Length = 599 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = -3 Query: 214 DPEIARWILEFLSRQ-SIDDRVFNGLISV--LPLPKADDRLMKFVLLRKISSEVSAGLIS 44 DP+I RW++EF+ RQ I N +++ +PL R K +LLR+I +++ G +S Sbjct: 14 DPDITRWVIEFILRQLQIPVLTINKILTNRHVPLSNTSPRFKKTLLLRQIDADIEDGSVS 73 Query: 43 EKILDSLEMIEEID 2 EK LD++EM+E+ID Sbjct: 74 EKTLDAIEMVEQID 87 >ref|XP_006376552.1| hypothetical protein POPTR_0013s15060g [Populus trichocarpa] gi|550325884|gb|ERP54349.1| hypothetical protein POPTR_0013s15060g [Populus trichocarpa] Length = 687 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = -3 Query: 214 DPEIARWILEFLSRQ-SIDDRVFNGLISV--LPLPKADDRLMKFVLLRKISSEVSAGLIS 44 DP+I RW++EF+ RQ I N +++ +PL R K +LLR+I +++ G +S Sbjct: 14 DPDITRWVIEFILRQLQIPVLTINKILTNRHVPLSNTSPRFKKTLLLRQIDADIEDGSVS 73 Query: 43 EKILDSLEMIEEID 2 EK LD++EM+E+ID Sbjct: 74 EKTLDAIEMVEQID 87 >ref|XP_007207092.1| hypothetical protein PRUPE_ppa023474mg [Prunus persica] gi|462402734|gb|EMJ08291.1| hypothetical protein PRUPE_ppa023474mg [Prunus persica] Length = 834 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/71 (40%), Positives = 45/71 (63%) Frame = -3 Query: 214 DPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEKI 35 D +++RW+LE L R + + +++V P D RL K VLLR I +V L+SE + Sbjct: 4 DVDVSRWVLELLIRDREKECIAKRVLAVAPFSDQDYRLKKTVLLRTIECDVYDALVSETM 63 Query: 34 LDSLEMIEEID 2 L++LEMIE++D Sbjct: 64 LETLEMIEDLD 74 >ref|XP_002519314.1| telomeric repeat binding protein, putative [Ricinus communis] gi|223541629|gb|EEF43178.1| telomeric repeat binding protein, putative [Ricinus communis] Length = 637 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/74 (43%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADD--RLMKFVLLRKISSEVSAGLIS 44 +D +I WI+E L R+ + + + ++ LP +D RL K +LLR I S++S G +S Sbjct: 4 LDTDITSWIMELLVRKELHEPLVKKFLTNPHLPLDNDNLRLKKTLLLRSIDSQISDGSVS 63 Query: 43 EKILDSLEMIEEID 2 E ILDSLE IEE+D Sbjct: 64 ETILDSLEAIEELD 77 >ref|XP_004500362.1| PREDICTED: uncharacterized protein LOC101503526 [Cicer arietinum] Length = 504 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/71 (39%), Positives = 44/71 (61%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +I+ W++EFL R S+ D + ++VLP+ AD RL K +LLR + ++ +SE Sbjct: 1 MDKDISNWVMEFLLRSSVPDSLIQKTLTVLPVSAADSRLKKTLLLRILQTQHLKASLSEM 60 Query: 37 ILDSLEMIEEI 5 L LE +EE+ Sbjct: 61 SLHILEQLEEL 71 >ref|XP_006591259.1| PREDICTED: uncharacterized protein LOC100819448 isoform X1 [Glycine max] gi|571489633|ref|XP_006591260.1| PREDICTED: uncharacterized protein LOC100819448 isoform X2 [Glycine max] Length = 507 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/69 (39%), Positives = 42/69 (60%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADDRLMKFVLLRKISSEVSAGLISEK 38 MD +I++W+ EFL R S+ D + ++ LPL A RL K +LLR + + + +SE Sbjct: 39 MDSDISQWVTEFLLRSSVPDSLIQKTLAALPLSTASPRLKKTLLLRTLQTLLRTATLSET 98 Query: 37 ILDSLEMIE 11 LD LE++E Sbjct: 99 ALDILELLE 107 >ref|XP_002518779.1| hypothetical protein RCOM_0813700 [Ricinus communis] gi|223542160|gb|EEF43704.1| hypothetical protein RCOM_0813700 [Ricinus communis] Length = 478 Score = 56.6 bits (135), Expect = 6e-06 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 4/76 (5%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKA---DDRLMKFVLLRKISSEVSAG-L 50 MDP I WILEFL+RQ I + N +++ +P A + R K +LLR I E++ G Sbjct: 1 MDPGITCWILEFLARQPISQLLLNKILTNTHIPIASINNPRFKKALLLRSIHDEIANGSA 60 Query: 49 ISEKILDSLEMIEEID 2 SE IL SLE IEE+D Sbjct: 61 SSETILQSLETIEELD 76 >ref|XP_006486662.1| PREDICTED: uncharacterized protein LOC102608364 [Citrus sinensis] Length = 396 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/76 (35%), Positives = 53/76 (69%), Gaps = 4/76 (5%) Frame = -3 Query: 217 MDPEIARWILEFLSRQSIDDRVFNGLISVLPLPKADD-RLMKFVLLRKISSEVSA---GL 50 MD +I+RW++EFL R S D++ N +++++P+ ++ RL K +LLR I S++S+ Sbjct: 1 MDEDISRWVIEFLLRNSPSDQLINRILAIIPISNNNNFRLKKTLLLRSIQSQLSSDGDAS 60 Query: 49 ISEKILDSLEMIEEID 2 +S+ IL++L+ + ++D Sbjct: 61 LSKTILENLKAVRDLD 76