BLASTX nr result
ID: Cocculus22_contig00021428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00021428 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855721.1| hypothetical protein AMTR_s00044p00151840 [A... 68 1e-09 ref|XP_007034168.1| Pentatricopeptide repeat-containing protein,... 68 1e-09 ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_007222864.1| hypothetical protein PRUPE_ppa004279mg [Prun... 67 3e-09 gb|EXC14264.1| hypothetical protein L484_021763 [Morus notabilis] 66 6e-09 ref|XP_006492991.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_006421046.1| hypothetical protein CICLE_v10004784mg [Citr... 65 7e-09 ref|XP_004298231.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_002321108.2| hypothetical protein POPTR_0014s14700g [Popu... 63 5e-08 ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_002516403.1| pentatricopeptide repeat-containing protein,... 59 5e-07 ref|XP_007163800.1| hypothetical protein PHAVU_001G265200g [Phas... 59 9e-07 >ref|XP_006855721.1| hypothetical protein AMTR_s00044p00151840 [Amborella trichopoda] gi|548859508|gb|ERN17188.1| hypothetical protein AMTR_s00044p00151840 [Amborella trichopoda] Length = 506 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVF 140 TDPLV TAF KG FLRSCEE++ +LG E++VWTY+DLID+VF Sbjct: 456 TDPLVLTAFGKGYFLRSCEELYLSLGAKGRERKVWTYNDLIDLVF 500 >ref|XP_007034168.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508713197|gb|EOY05094.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 504 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHK 149 TDPLV AF KG FLR CEE++++L P A +++ WTYH LID+V KHK Sbjct: 453 TDPLVLIAFGKGHFLRDCEEIYTSLEPKARKEKRWTYHHLIDLVIKHK 500 >ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Glycine max] Length = 509 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +3 Query: 3 KTDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHKG 152 KTD LV TAF KG FL+SCEEV+S+L P +++ WTYHDLI ++ KH G Sbjct: 452 KTDSLVLTAFGKGHFLKSCEEVYSSLHPEDRKRKTWTYHDLIALLSKHTG 501 >ref|XP_007222864.1| hypothetical protein PRUPE_ppa004279mg [Prunus persica] gi|462419800|gb|EMJ24063.1| hypothetical protein PRUPE_ppa004279mg [Prunus persica] Length = 518 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKH 146 TDPLV T F KG FLR+CE +S+L P E + WTYH LID+VFKH Sbjct: 463 TDPLVLTTFGKGHFLRNCEAAYSSLEPEDRENKTWTYHHLIDLVFKH 509 >gb|EXC14264.1| hypothetical protein L484_021763 [Morus notabilis] Length = 664 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHKGVKAQ 164 TDP+V TAF KG+FL++CE +S+L E + WTY++L+D+VFKHKG Q Sbjct: 454 TDPVVITAFGKGNFLQNCERAYSSLESEVRETKSWTYNNLVDLVFKHKGSDCQ 506 >ref|XP_006492991.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Citrus sinensis] Length = 477 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHKG 152 TDPLV + KG FLR CEEV+S+L P + EK+ WTY +LID+V KH G Sbjct: 422 TDPLVLAVYGKGHFLRYCEEVYSSLEPYSREKKRWTYQNLIDLVIKHNG 470 >ref|XP_006421046.1| hypothetical protein CICLE_v10004784mg [Citrus clementina] gi|557522919|gb|ESR34286.1| hypothetical protein CICLE_v10004784mg [Citrus clementina] Length = 510 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHKG 152 TDPLV + KG FLR CEEV+S+L P + EK+ WTY +LID+V KH G Sbjct: 455 TDPLVLAVYGKGHFLRYCEEVYSSLEPYSREKKRWTYQNLIDLVIKHNG 503 >ref|XP_004298231.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 509 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFK 143 TDPLV T F KG FLR+CE +S+L P EK+ WTY DLID VFK Sbjct: 460 TDPLVITTFGKGHFLRNCEAAYSSLEPEVREKKTWTYQDLIDSVFK 505 >ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like isoform X1 [Glycine max] Length = 506 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = +3 Query: 3 KTDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHKG 152 KTD LV TAF KG FL+SCEEV+S+L P +++ TYHDLI ++ KH G Sbjct: 450 KTDSLVLTAFGKGHFLKSCEEVYSSLHPEDRKRKTCTYHDLIPLLSKHTG 499 >ref|XP_002321108.2| hypothetical protein POPTR_0014s14700g [Populus trichocarpa] gi|550324215|gb|EEE99423.2| hypothetical protein POPTR_0014s14700g [Populus trichocarpa] Length = 508 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMV 137 TDPL +AF KGSFLRSCEE +S+L PNA EK+ WTY D I++V Sbjct: 460 TDPLALSAFGKGSFLRSCEEGYSSLEPNAREKKRWTYVDFINLV 503 >ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Vitis vinifera] Length = 581 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/43 (60%), Positives = 37/43 (86%) Frame = +3 Query: 6 TDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDM 134 TDPLV +AF KG+FL+SCEE++S+L P A +K++WTY +LID+ Sbjct: 481 TDPLVLSAFGKGNFLQSCEEMYSSLEPEARKKKIWTYQNLIDL 523 >ref|XP_002516403.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544501|gb|EEF46020.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 502 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +3 Query: 3 KTDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMVFKHKG 152 +TDPLV AF KG FL+ CEE +S+L P A +K WTY +LID+V + G Sbjct: 448 ETDPLVLAAFGKGQFLKKCEEAYSSLEPVARQKEKWTYCNLIDLVATYDG 497 >ref|XP_007163800.1| hypothetical protein PHAVU_001G265200g [Phaseolus vulgaris] gi|561037264|gb|ESW35794.1| hypothetical protein PHAVU_001G265200g [Phaseolus vulgaris] Length = 496 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +3 Query: 3 KTDPLVRTAFRKGSFLRSCEEVFSNLGPNATEKRVWTYHDLIDMV 137 KTD LV TAF KG FL+SCEEV+++L P E++ WTY+DLI ++ Sbjct: 451 KTDSLVLTAFGKGHFLKSCEEVYTSLHPEDRERKKWTYNDLIALL 495