BLASTX nr result
ID: Cocculus22_contig00021252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00021252 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004495593.1| PREDICTED: uncharacterized protein LOC101490... 59 9e-07 ref|XP_002526539.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002325785.2| hypothetical protein POPTR_0019s03960g [Popu... 58 2e-06 ref|XP_006371105.1| hypothetical protein POPTR_0019s03960g [Popu... 58 2e-06 ref|XP_006606472.1| PREDICTED: UPF0655 protein C17G9.12c-like [G... 57 3e-06 ref|XP_007208022.1| hypothetical protein PRUPE_ppa003119mg [Prun... 57 3e-06 ref|XP_007144024.1| hypothetical protein PHAVU_007G122700g [Phas... 56 5e-06 ref|XP_006375862.1| hypothetical protein POPTR_0013s04680g [Popu... 56 6e-06 >ref|XP_004495593.1| PREDICTED: uncharacterized protein LOC101490905 isoform X1 [Cicer arietinum] Length = 606 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 354 EFAESEAPNWKGLPGILYTVSSWAEIHAFILG 259 EF+E + NWKGL GILYTVSSWAE+HAF+LG Sbjct: 574 EFSEESSSNWKGLSGILYTVSSWAEVHAFVLG 605 >ref|XP_002526539.1| conserved hypothetical protein [Ricinus communis] gi|223534100|gb|EEF35817.1| conserved hypothetical protein [Ricinus communis] Length = 560 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 354 EFAESEAPNWKGLPGILYTVSSWAEIHAFILGL 256 E E +PNWK PG+LYTVSSWAEIHAFILGL Sbjct: 528 ELGEGVSPNWKAPPGVLYTVSSWAEIHAFILGL 560 >ref|XP_002325785.2| hypothetical protein POPTR_0019s03960g [Populus trichocarpa] gi|550316724|gb|EEF00167.2| hypothetical protein POPTR_0019s03960g [Populus trichocarpa] Length = 592 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 348 AESEAPNWKGLPGILYTVSSWAEIHAFILG 259 ++ E+PNWKGL GILYTVSSW+EIHAFILG Sbjct: 562 SDGESPNWKGLSGILYTVSSWSEIHAFILG 591 >ref|XP_006371105.1| hypothetical protein POPTR_0019s03960g [Populus trichocarpa] gi|118486577|gb|ABK95127.1| unknown [Populus trichocarpa] gi|550316725|gb|ERP48902.1| hypothetical protein POPTR_0019s03960g [Populus trichocarpa] Length = 618 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 348 AESEAPNWKGLPGILYTVSSWAEIHAFILG 259 ++ E+PNWKGL GILYTVSSW+EIHAFILG Sbjct: 588 SDGESPNWKGLSGILYTVSSWSEIHAFILG 617 >ref|XP_006606472.1| PREDICTED: UPF0655 protein C17G9.12c-like [Glycine max] Length = 502 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 354 EFAESEAPNWKGLPGILYTVSSWAEIHAFILG 259 E+ E NWKGL GILYTVSSWAE+HAFILG Sbjct: 470 EYVEGSTSNWKGLSGILYTVSSWAEVHAFILG 501 >ref|XP_007208022.1| hypothetical protein PRUPE_ppa003119mg [Prunus persica] gi|462403664|gb|EMJ09221.1| hypothetical protein PRUPE_ppa003119mg [Prunus persica] Length = 601 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 354 EFAESEAPNWKGLPGILYTVSSWAEIHAFILG 259 EF E + NWKGL GILYT SSWAEIHAFILG Sbjct: 569 EFIEGRSSNWKGLTGILYTASSWAEIHAFILG 600 >ref|XP_007144024.1| hypothetical protein PHAVU_007G122700g [Phaseolus vulgaris] gi|561017214|gb|ESW16018.1| hypothetical protein PHAVU_007G122700g [Phaseolus vulgaris] Length = 611 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 354 EFAESEAPNWKGLPGILYTVSSWAEIHAFILG 259 E+ E NWKGL G+LYTVSSWAE+HAFILG Sbjct: 579 EYVEGTTSNWKGLSGVLYTVSSWAEVHAFILG 610 >ref|XP_006375862.1| hypothetical protein POPTR_0013s04680g [Populus trichocarpa] gi|550324962|gb|ERP53659.1| hypothetical protein POPTR_0013s04680g [Populus trichocarpa] Length = 403 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 336 APNWKGLPGILYTVSSWAEIHAFILG 259 +PNWKGL GILYTVSSWAEIHAFILG Sbjct: 377 SPNWKGLSGILYTVSSWAEIHAFILG 402