BLASTX nr result
ID: Cocculus22_contig00021051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00021051 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006472040.1| PREDICTED: wall-associated receptor kinase-l... 57 2e-06 ref|XP_006433353.1| hypothetical protein CICLE_v10001697mg [Citr... 57 2e-06 >ref|XP_006472040.1| PREDICTED: wall-associated receptor kinase-like 17-like [Citrus sinensis] Length = 386 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/63 (49%), Positives = 38/63 (60%) Frame = -1 Query: 202 LKELVKAFGGKRNPIIVFTAKELAKATNNYDPNFIIRREPFYDLYKAIYKETTHNWIIVV 23 LKEL++A GK NP F+AKEL ATNNYD +I + FY LYK +E +I V Sbjct: 31 LKELIRASNGKYNPYCTFSAKELEIATNNYDSEKVIMKRSFYTLYKGFCQER----LISV 86 Query: 22 AKF 14 KF Sbjct: 87 MKF 89 >ref|XP_006433353.1| hypothetical protein CICLE_v10001697mg [Citrus clementina] gi|557535475|gb|ESR46593.1| hypothetical protein CICLE_v10001697mg [Citrus clementina] Length = 347 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/63 (49%), Positives = 38/63 (60%) Frame = -1 Query: 202 LKELVKAFGGKRNPIIVFTAKELAKATNNYDPNFIIRREPFYDLYKAIYKETTHNWIIVV 23 LKEL++A GK NP F+AKEL ATNNYD +I + FY LYK +E +I V Sbjct: 31 LKELIRASNGKYNPYCTFSAKELEIATNNYDSEKVIMKRSFYTLYKGFCQER----LISV 86 Query: 22 AKF 14 KF Sbjct: 87 MKF 89