BLASTX nr result
ID: Cocculus22_contig00020709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00020709 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223320.1| hypothetical protein PRUPE_ppa009514mg [Prun... 56 6e-06 >ref|XP_007223320.1| hypothetical protein PRUPE_ppa009514mg [Prunus persica] gi|462420256|gb|EMJ24519.1| hypothetical protein PRUPE_ppa009514mg [Prunus persica] Length = 289 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 LGFKPEDQSWVQLVESVCRERKLVKAFALLDELVI 105 +GFKP+ SW LVES+CRERKL+ AF LLDELV+ Sbjct: 251 MGFKPQPDSWALLVESICRERKLLSAFELLDELVV 285