BLASTX nr result
ID: Cocculus22_contig00020577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00020577 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28773.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002263849.1| PREDICTED: probable polyol transporter 4 [Vi... 57 3e-06 emb|CAN66670.1| hypothetical protein VITISV_017987 [Vitis vinifera] 57 3e-06 >emb|CBI28773.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = -2 Query: 152 ENGNKD-GLSGIPLGTKNKYQRMDLEVREDEDHQQKQLGRTSRDTMKYVVA 3 ENGN + GLSG+PLG+KNKY+RMD E+ E++D Q S T KYV A Sbjct: 8 ENGNGEMGLSGVPLGSKNKYRRMDSELTEEDDASQSHHHHVSNSTKKYVFA 58 >ref|XP_002263849.1| PREDICTED: probable polyol transporter 4 [Vitis vinifera] gi|310877844|gb|ADP37153.1| putative polyol/monosaccharide transporter [Vitis vinifera] Length = 526 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = -2 Query: 152 ENGNKD-GLSGIPLGTKNKYQRMDLEVREDEDHQQKQLGRTSRDTMKYVVA 3 ENGN + GLSG+PLG+KNKY+RMD E+ E++D Q S T KYV A Sbjct: 8 ENGNGEMGLSGVPLGSKNKYRRMDSELTEEDDASQSHHHHVSNSTKKYVFA 58 >emb|CAN66670.1| hypothetical protein VITISV_017987 [Vitis vinifera] Length = 526 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = -2 Query: 152 ENGNKD-GLSGIPLGTKNKYQRMDLEVREDEDHQQKQLGRTSRDTMKYVVA 3 ENGN + GLSG+PLG+KNKY+RMD E+ E++D Q S T KYV A Sbjct: 8 ENGNGEMGLSGVPLGSKNKYRRMDSELTEEDDASQSHHHHVSNSTKKYVFA 58