BLASTX nr result
ID: Cocculus22_contig00020559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00020559 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223573.1| hypothetical protein PRUPE_ppa012277mg [Prun... 57 2e-06 >ref|XP_007223573.1| hypothetical protein PRUPE_ppa012277mg [Prunus persica] gi|462420509|gb|EMJ24772.1| hypothetical protein PRUPE_ppa012277mg [Prunus persica] Length = 176 Score = 57.4 bits (137), Expect = 2e-06 Identities = 48/148 (32%), Positives = 65/148 (43%), Gaps = 23/148 (15%) Frame = -2 Query: 413 AIEAFEEHLINTEH-RSXXXXXXXXXKMGRRSIEKQAD-SEEIELLPVFQESVSEKGCLE 240 AIEAFE+HL N E + K+ RR + D + + + + VS + +E Sbjct: 29 AIEAFEDHLTNGEKTKKNSGRGKRRDKLSRREAPEPVDVAAQDSVFLEENDQVSHELAVE 88 Query: 239 GSES---PENEAFLVSLSDEMGGA----AXXXXXXXXXXXXVP--------------ASN 123 S S PEN+ LV +++ G A P ASN Sbjct: 89 SSASALLPENDVVLVGSNEKADGVEENDAKVEDLGAEVNLEPPETADDVAIIARTASASN 148 Query: 122 PRSSGRKSWPDVLGLFHSRLWSLWGPNI 39 R RK PDVLGLF+SRLW+LW PN+ Sbjct: 149 HRGLARKVLPDVLGLFNSRLWNLWSPNV 176