BLASTX nr result
ID: Cocculus22_contig00020424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00020424 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] 63 2e-11 >gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] Length = 601 Score = 63.2 bits (152), Expect(2) = 2e-11 Identities = 32/78 (41%), Positives = 48/78 (61%) Frame = -3 Query: 305 FPLFQNLSPRESLEIDPLLASLDSVRLHPHLQDRQSWTLDPSDLLTCKSLFSSFIDSPNF 126 F +N S RE E+ LL+ L+ VR+ L+DR W L+ S + +CKSLF+S +D+ +F Sbjct: 314 FHFRRNPSERELGEVVGLLSCLEGVRVCVALEDRWVWDLEGSGIFSCKSLFNSLVDNQSF 373 Query: 125 PDFIFAPFVWKAHIHQRL 72 P F F FVWK + ++ Sbjct: 374 PPFPFYYFVWKISVPTKI 391 Score = 30.8 bits (68), Expect(2) = 2e-11 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -1 Query: 403 FPS*YRISSLHS*PYCSFINNYPHQSNESISWNFHFSK 290 F + +R+S+LH+ SF Y ++ +ISWNFHF + Sbjct: 284 FSNLFRLSNLHNQAISSF---YSIGNDATISWNFHFRR 318