BLASTX nr result
ID: Cocculus22_contig00020394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00020394 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004290860.1| PREDICTED: heavy metal-associated isoprenyla... 125 5e-27 ref|XP_007029365.1| Heavy metal transport/detoxification superfa... 123 2e-26 ref|XP_002262627.1| PREDICTED: uncharacterized protein LOC100248... 120 2e-25 emb|CBI32881.3| unnamed protein product [Vitis vinifera] 119 3e-25 ref|XP_006846437.1| hypothetical protein AMTR_s00018p00061120 [A... 116 4e-24 ref|XP_003525732.2| PREDICTED: heavy metal-associated isoprenyla... 111 1e-22 ref|XP_004146252.1| PREDICTED: heavy metal-associated isoprenyla... 110 3e-22 ref|XP_004953465.1| PREDICTED: heavy metal-associated isoprenyla... 109 3e-22 gb|EEC73795.1| hypothetical protein OsI_08489 [Oryza sativa Indi... 109 5e-22 ref|XP_007202757.1| hypothetical protein PRUPE_ppa013392mg [Prun... 107 2e-21 ref|XP_007151507.1| hypothetical protein PHAVU_004G052700g [Phas... 106 3e-21 ref|XP_006402937.1| hypothetical protein EUTSA_v10006453mg [Eutr... 106 3e-21 ref|XP_006429717.1| hypothetical protein CICLE_v10013113mg [Citr... 106 4e-21 ref|XP_002878117.1| hypothetical protein ARALYDRAFT_324196 [Arab... 106 4e-21 ref|NP_001118849.1| metal ion binding protein [Arabidopsis thali... 106 4e-21 ref|XP_006293146.1| hypothetical protein CARUB_v10019458mg [Caps... 105 5e-21 ref|XP_003618919.1| Copper transport protein ATOX1-like protein ... 105 5e-21 ref|XP_004489636.1| PREDICTED: heavy metal-associated isoprenyla... 104 1e-20 ref|XP_004146251.1| PREDICTED: heavy metal-associated isoprenyla... 103 3e-20 gb|EYU28081.1| hypothetical protein MIMGU_mgv1a015827mg [Mimulus... 96 7e-18 >ref|XP_004290860.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Fragaria vesca subsp. vesca] Length = 149 Score = 125 bits (315), Expect = 5e-27 Identities = 59/74 (79%), Positives = 71/74 (95%) Frame = +2 Query: 17 KQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQV 196 K + S+AI+IVELLVHMDCEGC++RIR+AISK++GVDS+DIDMD+QKVTVTGYV+QR+V Sbjct: 8 KTSQISNAISIVELLVHMDCEGCEKRIRRAISKIDGVDSLDIDMDKQKVTVTGYVDQRKV 67 Query: 197 LKVVRRTGRKAEFW 238 LKVVRRTGRKAEFW Sbjct: 68 LKVVRRTGRKAEFW 81 >ref|XP_007029365.1| Heavy metal transport/detoxification superfamily protein isoform 1 [Theobroma cacao] gi|508717970|gb|EOY09867.1| Heavy metal transport/detoxification superfamily protein isoform 1 [Theobroma cacao] Length = 148 Score = 123 bits (309), Expect = 2e-26 Identities = 55/77 (71%), Positives = 72/77 (93%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W + + R S+A++IVELLVHMDCEGC++RIR+AISK++GVDS++IDMD+QKVTVTGY+++ Sbjct: 4 WLYGKTRFSNAMSIVELLVHMDCEGCEKRIRRAISKIDGVDSLEIDMDKQKVTVTGYIDE 63 Query: 188 RQVLKVVRRTGRKAEFW 238 R+VLKVVRRTGRKAE W Sbjct: 64 RKVLKVVRRTGRKAELW 80 >ref|XP_002262627.1| PREDICTED: uncharacterized protein LOC100248113 [Vitis vinifera] Length = 134 Score = 120 bits (301), Expect = 2e-25 Identities = 56/66 (84%), Positives = 64/66 (96%) Frame = +2 Query: 41 IAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVRRTG 220 ++IVELLVHMDCEGC++RIR+AISKL GVD +DIDMD+QKVTVTGYV+QRQVLKVVRRTG Sbjct: 1 MSIVELLVHMDCEGCEKRIRRAISKLSGVDHLDIDMDKQKVTVTGYVDQRQVLKVVRRTG 60 Query: 221 RKAEFW 238 RKAEFW Sbjct: 61 RKAEFW 66 >emb|CBI32881.3| unnamed protein product [Vitis vinifera] Length = 162 Score = 119 bits (299), Expect = 3e-25 Identities = 56/64 (87%), Positives = 62/64 (96%) Frame = +2 Query: 47 IVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVRRTGRK 226 IVELLVHMDCEGC++RIR+AISKL GVD +DIDMD+QKVTVTGYV+QRQVLKVVRRTGRK Sbjct: 31 IVELLVHMDCEGCEKRIRRAISKLSGVDHLDIDMDKQKVTVTGYVDQRQVLKVVRRTGRK 90 Query: 227 AEFW 238 AEFW Sbjct: 91 AEFW 94 >ref|XP_006846437.1| hypothetical protein AMTR_s00018p00061120 [Amborella trichopoda] gi|548849247|gb|ERN08112.1| hypothetical protein AMTR_s00018p00061120 [Amborella trichopoda] Length = 138 Score = 116 bits (290), Expect = 4e-24 Identities = 54/69 (78%), Positives = 65/69 (94%) Frame = +2 Query: 32 SDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVR 211 S+A++IVELLVHMDC GC+++IRKAISKLEGV S +IDMDRQKVTVTGY+NQR+VLK VR Sbjct: 2 SNAMSIVELLVHMDCIGCEKKIRKAISKLEGVGSYEIDMDRQKVTVTGYINQRKVLKAVR 61 Query: 212 RTGRKAEFW 238 R+G+KAEFW Sbjct: 62 RSGKKAEFW 70 >ref|XP_003525732.2| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Glycine max] Length = 148 Score = 111 bits (277), Expect = 1e-22 Identities = 50/77 (64%), Positives = 66/77 (85%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W ++ + A++IVEL VHMDC+GC+ RIR+AISKL G+DS+DIDMD+QKVTVTGYV + Sbjct: 4 WRPRKNKLPKALSIVELKVHMDCQGCEERIRRAISKLNGIDSLDIDMDQQKVTVTGYVEK 63 Query: 188 RQVLKVVRRTGRKAEFW 238 +VL++VRRTGRKAE+W Sbjct: 64 GKVLRIVRRTGRKAEYW 80 >ref|XP_004146252.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 2 [Cucumis sativus] gi|449495525|ref|XP_004159867.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 2 [Cucumis sativus] Length = 148 Score = 110 bits (274), Expect = 3e-22 Identities = 50/75 (66%), Positives = 66/75 (88%) Frame = +2 Query: 14 FKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQ 193 F + + S+A++IVELLVHMDC GC+ RIR+A+SK+EGV S++IDM++QKVTVTGYV +R+ Sbjct: 6 FHRKKSSNAMSIVELLVHMDCNGCEGRIRRAVSKIEGVHSLEIDMNKQKVTVTGYVEERK 65 Query: 194 VLKVVRRTGRKAEFW 238 VLK+VR TGRKAE W Sbjct: 66 VLKMVRGTGRKAELW 80 >ref|XP_004953465.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Setaria italica] Length = 150 Score = 109 bits (273), Expect = 3e-22 Identities = 51/81 (62%), Positives = 69/81 (85%), Gaps = 3/81 (3%) Frame = +2 Query: 5 FWCFKQPRPS---DAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTG 175 FW + PR S +A+++VE+ VHMDC+GC++R+RKA+S+LEGV S++IDMDRQKVTVTG Sbjct: 4 FW--RWPRSSTLSNALSVVEMNVHMDCDGCEKRVRKAMSRLEGVSSVEIDMDRQKVTVTG 61 Query: 176 YVNQRQVLKVVRRTGRKAEFW 238 YV++R+VL+ RRTGR AEFW Sbjct: 62 YVDRREVLRAARRTGRAAEFW 82 >gb|EEC73795.1| hypothetical protein OsI_08489 [Oryza sativa Indica Group] Length = 150 Score = 109 bits (272), Expect = 5e-22 Identities = 48/69 (69%), Positives = 63/69 (91%) Frame = +2 Query: 32 SDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVR 211 SDA++IVE+ VHMDCEGC++R+RKA+S+LEGV +++IDMD QKVTVTGYV++R+VL+ R Sbjct: 14 SDALSIVEMNVHMDCEGCEKRVRKAMSRLEGVSTVEIDMDTQKVTVTGYVDRREVLRAAR 73 Query: 212 RTGRKAEFW 238 RTGR AEFW Sbjct: 74 RTGRAAEFW 82 >ref|XP_007202757.1| hypothetical protein PRUPE_ppa013392mg [Prunus persica] gi|462398288|gb|EMJ03956.1| hypothetical protein PRUPE_ppa013392mg [Prunus persica] Length = 125 Score = 107 bits (266), Expect = 2e-21 Identities = 48/57 (84%), Positives = 57/57 (100%) Frame = +2 Query: 68 MDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVRRTGRKAEFW 238 MDCEGC++RIR+AISK+EGVDS++IDMD+QKVTVTGYV+QR+VLKVVRRTGRKAEFW Sbjct: 1 MDCEGCEKRIRRAISKIEGVDSLEIDMDKQKVTVTGYVDQRKVLKVVRRTGRKAEFW 57 >ref|XP_007151507.1| hypothetical protein PHAVU_004G052700g [Phaseolus vulgaris] gi|561024816|gb|ESW23501.1| hypothetical protein PHAVU_004G052700g [Phaseolus vulgaris] Length = 146 Score = 106 bits (265), Expect = 3e-21 Identities = 52/79 (65%), Positives = 66/79 (83%) Frame = +2 Query: 2 MFWCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYV 181 MF K+ P+ ++IVEL VHMDC+GC+ RIR+AISKL GVDS+DIDMD+QKVTVTGYV Sbjct: 1 MFGWRKKKLPN-VLSIVELKVHMDCQGCEGRIRRAISKLNGVDSLDIDMDQQKVTVTGYV 59 Query: 182 NQRQVLKVVRRTGRKAEFW 238 + +VL+ VRRTGR+AE+W Sbjct: 60 EKGKVLRSVRRTGRRAEYW 78 >ref|XP_006402937.1| hypothetical protein EUTSA_v10006453mg [Eutrema salsugineum] gi|557104036|gb|ESQ44390.1| hypothetical protein EUTSA_v10006453mg [Eutrema salsugineum] Length = 153 Score = 106 bits (265), Expect = 3e-21 Identities = 48/77 (62%), Positives = 65/77 (84%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W R A++IVELLV MDC+GC+R++R+AISKL+GVD+++ID+DRQKVTVTGYV++ Sbjct: 4 WVHGNSRLPLALSIVELLVDMDCQGCERKVRRAISKLDGVDTVEIDVDRQKVTVTGYVDR 63 Query: 188 RQVLKVVRRTGRKAEFW 238 +VLK+V+RTGR EFW Sbjct: 64 EEVLKMVKRTGRVVEFW 80 >ref|XP_006429717.1| hypothetical protein CICLE_v10013113mg [Citrus clementina] gi|557531774|gb|ESR42957.1| hypothetical protein CICLE_v10013113mg [Citrus clementina] Length = 125 Score = 106 bits (264), Expect = 4e-21 Identities = 47/57 (82%), Positives = 57/57 (100%) Frame = +2 Query: 68 MDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVRRTGRKAEFW 238 MDCEGC++RIR+AISK++GVDS+DIDMD+QKVTVTGYV++R+VLKVVRRTGRKAEFW Sbjct: 1 MDCEGCEKRIRRAISKIDGVDSLDIDMDKQKVTVTGYVDERKVLKVVRRTGRKAEFW 57 >ref|XP_002878117.1| hypothetical protein ARALYDRAFT_324196 [Arabidopsis lyrata subsp. lyrata] gi|297323955|gb|EFH54376.1| hypothetical protein ARALYDRAFT_324196 [Arabidopsis lyrata subsp. lyrata] Length = 170 Score = 106 bits (264), Expect = 4e-21 Identities = 47/77 (61%), Positives = 66/77 (85%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W R A++IVELLV MDC+GC++++R+AISKL+GVD+++ID+DRQKVTVTGYV++ Sbjct: 4 WIHGNSRLPIALSIVELLVDMDCQGCEKKVRRAISKLDGVDTIEIDVDRQKVTVTGYVDR 63 Query: 188 RQVLKVVRRTGRKAEFW 238 +VLK+V++TGR AEFW Sbjct: 64 EEVLKMVKQTGRTAEFW 80 >ref|NP_001118849.1| metal ion binding protein [Arabidopsis thaliana] gi|332646062|gb|AEE79583.1| metal ion binding protein [Arabidopsis thaliana] Length = 166 Score = 106 bits (264), Expect = 4e-21 Identities = 47/77 (61%), Positives = 66/77 (85%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W R A++IVELLV MDC+GC++++R+AISKL+GVD+++ID+DRQKVTVTGYV++ Sbjct: 4 WIHGNSRLPIALSIVELLVDMDCKGCEKKVRRAISKLDGVDTVEIDVDRQKVTVTGYVDR 63 Query: 188 RQVLKVVRRTGRKAEFW 238 +VLK+V+RTGR AE+W Sbjct: 64 EEVLKMVKRTGRTAEYW 80 >ref|XP_006293146.1| hypothetical protein CARUB_v10019458mg [Capsella rubella] gi|482561853|gb|EOA26044.1| hypothetical protein CARUB_v10019458mg [Capsella rubella] Length = 173 Score = 105 bits (263), Expect = 5e-21 Identities = 47/77 (61%), Positives = 65/77 (84%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W R +++IVELLV MDC+GC++++R+AISKL+GVD+++ID+DRQKVTVTGYV++ Sbjct: 4 WIHGNSRLPISLSIVELLVDMDCQGCEKKVRRAISKLDGVDTVEIDVDRQKVTVTGYVDR 63 Query: 188 RQVLKVVRRTGRKAEFW 238 VLK+V+RTGR AEFW Sbjct: 64 EDVLKMVKRTGRTAEFW 80 >ref|XP_003618919.1| Copper transport protein ATOX1-like protein [Medicago truncatula] gi|355493934|gb|AES75137.1| Copper transport protein ATOX1-like protein [Medicago truncatula] Length = 148 Score = 105 bits (263), Expect = 5e-21 Identities = 48/77 (62%), Positives = 65/77 (84%) Frame = +2 Query: 8 WCFKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQ 187 W + R +A++IVEL VHMDC+GC+ RIR+ ISKL GVDS++IDM+ QKVTVTGYV++ Sbjct: 4 WRPWKTRIPNALSIVELKVHMDCQGCEERIRRVISKLNGVDSLEIDMENQKVTVTGYVDK 63 Query: 188 RQVLKVVRRTGRKAEFW 238 +VL++VR+TGRKAE+W Sbjct: 64 SKVLRMVRKTGRKAEYW 80 >ref|XP_004489636.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cicer arietinum] Length = 148 Score = 104 bits (260), Expect = 1e-20 Identities = 46/68 (67%), Positives = 61/68 (89%) Frame = +2 Query: 35 DAIAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVRR 214 +A++IVEL VHMDC+GC+ RIR+ ISKL GVDS++IDM+ QKVTV GYV++ +VL++VRR Sbjct: 13 NALSIVELKVHMDCQGCEERIRRVISKLNGVDSLEIDMENQKVTVIGYVDKSKVLRIVRR 72 Query: 215 TGRKAEFW 238 TGRKAE+W Sbjct: 73 TGRKAEYW 80 >ref|XP_004146251.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 1 [Cucumis sativus] gi|449495523|ref|XP_004159866.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 1 [Cucumis sativus] Length = 155 Score = 103 bits (256), Expect = 3e-20 Identities = 50/82 (60%), Positives = 66/82 (80%), Gaps = 7/82 (8%) Frame = +2 Query: 14 FKQPRPSDAIAIVELLVHMDCEGCQRRIRKAISKLE-------GVDSMDIDMDRQKVTVT 172 F + + S+A++IVELLVHMDC GC+ RIR+A+SK+E GV S++IDM++QKVTVT Sbjct: 6 FHRKKSSNAMSIVELLVHMDCNGCEGRIRRAVSKIEESNVTKTGVHSLEIDMNKQKVTVT 65 Query: 173 GYVNQRQVLKVVRRTGRKAEFW 238 GYV +R+VLK+VR TGRKAE W Sbjct: 66 GYVEERKVLKMVRGTGRKAELW 87 >gb|EYU28081.1| hypothetical protein MIMGU_mgv1a015827mg [Mimulus guttatus] Length = 144 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/66 (66%), Positives = 55/66 (83%) Frame = +2 Query: 41 IAIVELLVHMDCEGCQRRIRKAISKLEGVDSMDIDMDRQKVTVTGYVNQRQVLKVVRRTG 220 + IVEL VHMDC GC+RR+ KA+SKL+GVD++DIDM+ QKVTVTG +Q++VLK VR TG Sbjct: 1 MTIVELRVHMDCPGCERRVTKALSKLDGVDNVDIDMNMQKVTVTGRTDQKKVLKKVRSTG 60 Query: 221 RKAEFW 238 R AE W Sbjct: 61 RTAELW 66