BLASTX nr result
ID: Cocculus22_contig00020009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00020009 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO01498.1| putative glucose-repressible protein [Togninia mi... 69 7e-10 ref|XP_003718290.1| glucose-repressible protein [Magnaporthe ory... 62 6e-08 ref|XP_001229043.1| hypothetical protein CHGG_02527 [Chaetomium ... 62 8e-08 gb|AAY85814.1| glucose-repressible protein [Chaetomium globosum] 62 8e-08 gb|EFX05357.1| glucose-repressible protein [Grosmannia clavigera... 60 2e-07 ref|XP_003648991.1| hypothetical protein THITE_2107085 [Thielavi... 60 3e-07 gb|ETN46990.1| hypothetical protein HMPREF1541_01180 [Cyphelloph... 59 5e-07 gb|EJT80590.1| glucose-repressible protein [Gaeumannomyces grami... 59 5e-07 ref|XP_003661469.1| hypothetical protein MYCTH_2314555 [Myceliop... 56 6e-06 >gb|EOO01498.1| putative glucose-repressible protein [Togninia minima UCRPA7] Length = 71 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKDSN +G RA+AG DALKDKSKEH HDA AEANKQ ATH Sbjct: 31 AKDSNAPVGTRAEAGYDALKDKSKEHSHDAQAEANKQAATH 71 >ref|XP_003718290.1| glucose-repressible protein [Magnaporthe oryzae 70-15] gi|59803120|gb|AAX07712.1| glucose-repressible gene protein-like protein [Magnaporthe grisea] gi|291195727|gb|ADD84580.1| glucose-repressible protein [Magnaporthe oryzae] gi|351640843|gb|EHA48706.1| glucose-repressible protein [Magnaporthe oryzae 70-15] gi|440466814|gb|ELQ36058.1| hypothetical protein OOU_Y34scaffold00669g43 [Magnaporthe oryzae Y34] gi|440480298|gb|ELQ60972.1| hypothetical protein OOW_P131scaffold01213g44 [Magnaporthe oryzae P131] Length = 71 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKD+N +G RA+AG+DALKDK EH+HDASA ANK+ A H Sbjct: 31 AKDNNASLGTRAEAGIDALKDKGNEHKHDASATANKEAAKH 71 >ref|XP_001229043.1| hypothetical protein CHGG_02527 [Chaetomium globosum CBS 148.51] gi|88183124|gb|EAQ90592.1| hypothetical protein CHGG_02527 [Chaetomium globosum CBS 148.51] Length = 71 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKD+N G+G R QA DA+ DK+KEH++DASAEANKQ ATH Sbjct: 31 AKDNNAGVGTRLQAAGDAIGDKAKEHKYDASAEANKQAATH 71 >gb|AAY85814.1| glucose-repressible protein [Chaetomium globosum] Length = 71 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKD+N G+G R QA DA+ DK+KEH++DASAEANKQ ATH Sbjct: 31 AKDNNAGVGTRLQAAGDAIGDKAKEHKYDASAEANKQAATH 71 >gb|EFX05357.1| glucose-repressible protein [Grosmannia clavigera kw1407] Length = 71 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 A DSN IG RAQAGVDA+K+K+ E +HD SAEANKQ ATH Sbjct: 31 ASDSNQSIGTRAQAGVDAVKNKATETKHDTSAEANKQAATH 71 >ref|XP_003648991.1| hypothetical protein THITE_2107085 [Thielavia terrestris NRRL 8126] gi|346996252|gb|AEO62655.1| hypothetical protein THITE_2107085 [Thielavia terrestris NRRL 8126] Length = 71 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKD N GIG R QA DA+ DK+KE +HDASAEANKQ TH Sbjct: 31 AKDENAGIGTRLQAAGDAISDKTKEKKHDASAEANKQATTH 71 >gb|ETN46990.1| hypothetical protein HMPREF1541_01180 [Cyphellophora europaea CBS 101466] Length = 71 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKDSNV + RA A DAL DK+ EH+H ASAEANKQ+ATH Sbjct: 31 AKDSNVDVSTRASAAKDALGDKADEHKHGASAEANKQRATH 71 >gb|EJT80590.1| glucose-repressible protein [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 71 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AKD N +G R +AG DA+ DK EH+HD SAE NKQKATH Sbjct: 31 AKDGNASVGTRFEAGKDAISDKVDEHKHDTSAEVNKQKATH 71 >ref|XP_003661469.1| hypothetical protein MYCTH_2314555 [Myceliophthora thermophila ATCC 42464] gi|347008737|gb|AEO56224.1| hypothetical protein MYCTH_2314555 [Myceliophthora thermophila ATCC 42464] Length = 71 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 356 AKDSNVGIGNRAQAGVDALKDKSKEHQHDASAEANKQKATH 234 AK+ N IG R QA DA+ DK KEH+ DASAEANKQ ATH Sbjct: 31 AKNENANIGTRVQAAGDAVADKVKEHKDDASAEANKQAATH 71