BLASTX nr result
ID: Cocculus22_contig00019991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00019991 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citr... 64 3e-08 >ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] gi|557546496|gb|ESR57474.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] Length = 83 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +3 Query: 81 GCRLSVLAMGKVCCSELDEG-GIEFMGFLMALVIALALMFICSPPPRRSVVAVYRL 245 G SV MGK+ CSE+++ G++FMG LM LV+AL LM IC PPPRR +V YR+ Sbjct: 27 GLGSSVFDMGKLICSEIEQTFGLDFMGLLMVLVLALTLMVICVPPPRRYMVTAYRV 82