BLASTX nr result
ID: Cocculus22_contig00019731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00019731 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850923.1| hypothetical protein AMTR_s00025p00180980 [A... 66 6e-09 gb|EMT19213.1| hypothetical protein F775_08226 [Aegilops tauschii] 65 1e-08 gb|EMS54921.1| Notchless protein-like protein [Triticum urartu] 65 1e-08 ref|XP_002991264.1| hypothetical protein SELMODRAFT_236231 [Sela... 64 2e-08 ref|XP_006663572.1| PREDICTED: notchless protein homolog [Oryza ... 63 4e-08 ref|XP_006661596.1| PREDICTED: notchless protein homolog [Oryza ... 63 4e-08 ref|XP_004960978.1| PREDICTED: notchless protein homolog isoform... 63 4e-08 ref|NP_001064020.1| Os10g0104500 [Oryza sativa Japonica Group] g... 63 4e-08 ref|NP_001068204.1| Os11g0594200 [Oryza sativa Japonica Group] g... 63 4e-08 ref|XP_003567777.1| PREDICTED: notchless protein homolog [Brachy... 63 4e-08 dbj|BAJ85438.1| predicted protein [Hordeum vulgare subsp. vulgar... 63 4e-08 ref|XP_002991199.1| hypothetical protein SELMODRAFT_133091 [Sela... 63 4e-08 gb|EEC66453.1| hypothetical protein OsI_32506 [Oryza sativa Indi... 63 4e-08 gb|AAK00422.2| Putative notchless protein homolog [Oryza sativa ... 63 4e-08 ref|XP_007217953.1| hypothetical protein PRUPE_ppa005167mg [Prun... 62 6e-08 ref|XP_006492689.1| PREDICTED: notchless protein homolog [Citrus... 62 8e-08 ref|XP_006344444.1| PREDICTED: notchless protein homolog [Solanu... 62 8e-08 ref|XP_006445884.1| hypothetical protein CICLE_v10015115mg [Citr... 62 8e-08 ref|XP_002313318.2| hypothetical protein POPTR_0009s06310g [Popu... 62 8e-08 ref|XP_004236242.1| PREDICTED: notchless protein homolog [Solanu... 62 8e-08 >ref|XP_006850923.1| hypothetical protein AMTR_s00025p00180980 [Amborella trichopoda] gi|548854594|gb|ERN12504.1| hypothetical protein AMTR_s00025p00180980 [Amborella trichopoda] Length = 485 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEVFAVDWSPDGEKVVSGG+DRVLKLWMN Sbjct: 456 ADEVFAVDWSPDGEKVVSGGKDRVLKLWMN 485 >gb|EMT19213.1| hypothetical protein F775_08226 [Aegilops tauschii] Length = 462 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKVVSGG+DRVLKLWMN Sbjct: 433 ADEVYAVDWSPDGEKVVSGGKDRVLKLWMN 462 >gb|EMS54921.1| Notchless protein-like protein [Triticum urartu] Length = 533 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKVVSGG+DRVLKLWMN Sbjct: 504 ADEVYAVDWSPDGEKVVSGGKDRVLKLWMN 533 >ref|XP_002991264.1| hypothetical protein SELMODRAFT_236231 [Selaginella moellendorffii] gi|300140975|gb|EFJ07692.1| hypothetical protein SELMODRAFT_236231 [Selaginella moellendorffii] Length = 474 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEVFAVDWSPDG+KV SGGRDRVLKLWMN Sbjct: 445 ADEVFAVDWSPDGQKVASGGRDRVLKLWMN 474 >ref|XP_006663572.1| PREDICTED: notchless protein homolog [Oryza brachyantha] Length = 478 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 449 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 478 >ref|XP_006661596.1| PREDICTED: notchless protein homolog [Oryza brachyantha] Length = 471 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 442 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 471 >ref|XP_004960978.1| PREDICTED: notchless protein homolog isoform X1 [Setaria italica] gi|514745840|ref|XP_004960979.1| PREDICTED: notchless protein homolog isoform X2 [Setaria italica] Length = 480 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 451 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 480 >ref|NP_001064020.1| Os10g0104500 [Oryza sativa Japonica Group] gi|78707607|gb|ABB46582.1| Notchless, putative, expressed [Oryza sativa Japonica Group] gi|113638629|dbj|BAF25934.1| Os10g0104500 [Oryza sativa Japonica Group] gi|222612317|gb|EEE50449.1| hypothetical protein OsJ_30462 [Oryza sativa Japonica Group] Length = 480 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 451 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 480 >ref|NP_001068204.1| Os11g0594200 [Oryza sativa Japonica Group] gi|77551780|gb|ABA94577.1| Notchless, putative, expressed [Oryza sativa Japonica Group] gi|113645426|dbj|BAF28567.1| Os11g0594200 [Oryza sativa Japonica Group] gi|215767303|dbj|BAG99531.1| unnamed protein product [Oryza sativa Japonica Group] gi|222616248|gb|EEE52380.1| hypothetical protein OsJ_34468 [Oryza sativa Japonica Group] Length = 480 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 451 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 480 >ref|XP_003567777.1| PREDICTED: notchless protein homolog [Brachypodium distachyon] Length = 471 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKVVSGG+DR LKLWMN Sbjct: 442 ADEVYAVDWSPDGEKVVSGGKDRALKLWMN 471 >dbj|BAJ85438.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326524604|dbj|BAK00685.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 475 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKVVSGG+DR LKLWMN Sbjct: 446 ADEVYAVDWSPDGEKVVSGGKDRALKLWMN 475 >ref|XP_002991199.1| hypothetical protein SELMODRAFT_133091 [Selaginella moellendorffii] gi|300141027|gb|EFJ07743.1| hypothetical protein SELMODRAFT_133091 [Selaginella moellendorffii] Length = 486 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEVFAVDWSPDG+KV SGG+DRVLKLWMN Sbjct: 457 ADEVFAVDWSPDGQKVASGGKDRVLKLWMN 486 >gb|EEC66453.1| hypothetical protein OsI_32506 [Oryza sativa Indica Group] Length = 130 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 101 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 130 >gb|AAK00422.2| Putative notchless protein homolog [Oryza sativa Japonica Group] Length = 447 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWMN 251 ADEV+AVDWSPDGEKV SGG+DRVLKLWMN Sbjct: 418 ADEVYAVDWSPDGEKVASGGKDRVLKLWMN 447 >ref|XP_007217953.1| hypothetical protein PRUPE_ppa005167mg [Prunus persica] gi|462414415|gb|EMJ19152.1| hypothetical protein PRUPE_ppa005167mg [Prunus persica] Length = 474 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWM 254 ADEV+AVDWSPDGEKVVSGG+DRVLKLWM Sbjct: 445 ADEVYAVDWSPDGEKVVSGGKDRVLKLWM 473 >ref|XP_006492689.1| PREDICTED: notchless protein homolog [Citrus sinensis] Length = 473 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWM 254 ADEVFAVDWSPDGEKV SGG+DRVLKLWM Sbjct: 444 ADEVFAVDWSPDGEKVASGGKDRVLKLWM 472 >ref|XP_006344444.1| PREDICTED: notchless protein homolog [Solanum tuberosum] Length = 485 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWM 254 ADEVFAVDWSPDGEKV SGG+DRVLKLWM Sbjct: 456 ADEVFAVDWSPDGEKVASGGKDRVLKLWM 484 >ref|XP_006445884.1| hypothetical protein CICLE_v10015115mg [Citrus clementina] gi|557548495|gb|ESR59124.1| hypothetical protein CICLE_v10015115mg [Citrus clementina] Length = 473 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWM 254 ADEVFAVDWSPDGEKV SGG+DRVLKLWM Sbjct: 444 ADEVFAVDWSPDGEKVASGGKDRVLKLWM 472 >ref|XP_002313318.2| hypothetical protein POPTR_0009s06310g [Populus trichocarpa] gi|550331158|gb|EEE87273.2| hypothetical protein POPTR_0009s06310g [Populus trichocarpa] Length = 471 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWM 254 ADEVFAVDWSPDGEKV SGG+DRVLKLWM Sbjct: 442 ADEVFAVDWSPDGEKVASGGKDRVLKLWM 470 >ref|XP_004236242.1| PREDICTED: notchless protein homolog [Solanum lycopersicum] Length = 485 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 340 ADEVFAVDWSPDGEKVVSGGRDRVLKLWM 254 ADEVFAVDWSPDGEKV SGG+DRVLKLWM Sbjct: 456 ADEVFAVDWSPDGEKVASGGKDRVLKLWM 484