BLASTX nr result
ID: Cocculus22_contig00019379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00019379 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446901.1| hypothetical protein CICLE_v10014656mg [Citr... 57 3e-06 >ref|XP_006446901.1| hypothetical protein CICLE_v10014656mg [Citrus clementina] gi|557549512|gb|ESR60141.1| hypothetical protein CICLE_v10014656mg [Citrus clementina] Length = 602 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/58 (43%), Positives = 36/58 (62%) Frame = -1 Query: 279 RTYFVCPVKKGQGACNFFQWEDGAGHDSNDDHLGEKEPFTSSQSTMDREDRNSYSVNN 106 R+YFVCP+KKG GAC FFQWED ++H E + +++S S D ++ SV + Sbjct: 127 RSYFVCPIKKGLGACPFFQWEDTQADAKVNEHRDESKGYSASLSAGDSPQSDNLSVEH 184