BLASTX nr result
ID: Cocculus22_contig00019215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00019215 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49036.1| hypothetical protein DOTSEDRAFT_40277 [Dothistrom... 59 9e-07 >gb|EME49036.1| hypothetical protein DOTSEDRAFT_40277 [Dothistroma septosporum NZE10] Length = 112 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 323 YLKQAQDGASDLVGQASETVSSGVKQAQDALGMN 222 YLKQAQDGA++L QASET+S+GVKQAQDALG+N Sbjct: 74 YLKQAQDGAANLANQASETISAGVKQAQDALGLN 107