BLASTX nr result
ID: Cocculus22_contig00018960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018960 (571 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB98011.1| SWI/SNF complex component SNF12-like protein [Mor... 56 8e-06 >gb|EXB98011.1| SWI/SNF complex component SNF12-like protein [Morus notabilis] Length = 544 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/56 (50%), Positives = 33/56 (58%) Frame = +2 Query: 308 MSANNINPTRNVGGPSPLGNNAGMVSSPLSMNHPSHLHPQSQGQTPDGSHFQSQFQ 475 MS NN N +NVG P GN+ GMV + +NH HL Q+Q QT GSHF FQ Sbjct: 1 MSMNNNNQVKNVGAPPHFGNS-GMVPQSMPLNHQPHLLSQAQPQTQSGSHFPGHFQ 55