BLASTX nr result
ID: Cocculus22_contig00018727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018727 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597600.1| Serine/threonine protein kinase [Medicago tr... 56 6e-06 gb|EXB55541.1| Serine/threonine-protein kinase fray2 [Morus nota... 55 8e-06 >ref|XP_003597600.1| Serine/threonine protein kinase [Medicago truncatula] gi|124360373|gb|ABN08386.1| Protein kinase [Medicago truncatula] gi|355486648|gb|AES67851.1| Serine/threonine protein kinase [Medicago truncatula] Length = 518 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 93 KHRRISGWNFNEEVFQLVPVFPTERSEDNNIVKQVGLCEVLINEE 227 K RRISGWNFNE+ +LVPVFP ++S+D+ +VKQV E + +E Sbjct: 357 KQRRISGWNFNEDGLELVPVFPKDQSKDDEVVKQVRFEEEKVIQE 401 >gb|EXB55541.1| Serine/threonine-protein kinase fray2 [Morus notabilis] Length = 563 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 90 EKHRRISGWNFNEEVFQLVPVFPTERSEDNNIVKQV 197 EK RRISGWNFNE+ F+L PVFPT+ SED+++VKQV Sbjct: 361 EKRRRISGWNFNEDGFKLDPVFPTD-SEDDSVVKQV 395