BLASTX nr result
ID: Cocculus22_contig00018700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018700 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021867.1| Craniofacial development protein 1, putative... 59 5e-07 ref|XP_002283379.1| PREDICTED: uncharacterized protein LOC100267... 56 5e-06 emb|CAN60929.1| hypothetical protein VITISV_008358 [Vitis vinifera] 56 5e-06 ref|XP_006360032.1| PREDICTED: uncharacterized protein LOC102580... 55 8e-06 >ref|XP_007021867.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] gi|590610623|ref|XP_007021868.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] gi|508721495|gb|EOY13392.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] gi|508721496|gb|EOY13393.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] Length = 317 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +2 Query: 104 DAMRVLSLYAMDSVPVQLVIPDEIKDSVSKLLKEVINLSE 223 D M+V++LYA+D VP +L +PDE+KDSVS+LLKEVI LS+ Sbjct: 276 DVMKVIALYALDQVPPKLTVPDEVKDSVSRLLKEVIKLSQ 315 >ref|XP_002283379.1| PREDICTED: uncharacterized protein LOC100267416 [Vitis vinifera] gi|302142872|emb|CBI20167.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 110 MRVLSLYAMDSVPVQLVIPDEIKDSVSKLLKEVINLSE 223 MR+L+LYAM+S+P QLV+PDE+K SV +LLKEV+ LSE Sbjct: 290 MRLLTLYAMESMPPQLVLPDEVKASVGRLLKEVLRLSE 327 >emb|CAN60929.1| hypothetical protein VITISV_008358 [Vitis vinifera] Length = 330 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 110 MRVLSLYAMDSVPVQLVIPDEIKDSVSKLLKEVINLSE 223 MR+L+LYAM+S+P QLV+PDE+K SV +LLKEV+ LSE Sbjct: 290 MRLLTLYAMESMPPQLVLPDEVKASVGRLLKEVLRLSE 327 >ref|XP_006360032.1| PREDICTED: uncharacterized protein LOC102580802 isoform X1 [Solanum tuberosum] Length = 352 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +2 Query: 101 ADAMRVLSLYAMDSVPVQLVIPDEIKDSVSKLLKEVINLSE 223 A MRV++LYA++SVP QLVIPDEIK SVS+LL +++ LS+ Sbjct: 309 AGVMRVITLYALESVPPQLVIPDEIKASVSRLLMDILRLSQ 349