BLASTX nr result
ID: Cocculus22_contig00018677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018677 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444303.1| hypothetical protein CICLE_v10020175mg [Citr... 80 2e-13 ref|XP_006444302.1| hypothetical protein CICLE_v10020175mg [Citr... 80 2e-13 ref|XP_002302707.2| transducin family protein [Populus trichocar... 78 1e-12 ref|XP_007050892.1| Transducin/WD40 repeat-like superfamily prot... 78 1e-12 ref|XP_002320348.2| transducin family protein [Populus trichocar... 77 2e-12 gb|EXB36417.1| WD repeat-containing protein 89-like protein [Mor... 76 5e-12 ref|XP_003521563.2| PREDICTED: WD repeat-containing protein 89 h... 74 2e-11 ref|XP_004156840.1| PREDICTED: WD repeat-containing protein 89 h... 74 2e-11 ref|XP_004152255.1| PREDICTED: WD repeat-containing protein 89 h... 74 2e-11 ref|XP_002523062.1| WD-repeat protein, putative [Ricinus communi... 74 2e-11 gb|ACU19046.1| unknown [Glycine max] 73 5e-11 ref|XP_006840546.1| hypothetical protein AMTR_s00045p00215170 [A... 72 8e-11 ref|XP_004494371.1| PREDICTED: WD repeat-containing protein 89 h... 72 8e-11 ref|XP_004290782.1| PREDICTED: WD repeat-containing protein 89 h... 70 2e-10 ref|XP_002264804.1| PREDICTED: WD repeat-containing protein 89 h... 70 2e-10 emb|CAN75889.1| hypothetical protein VITISV_023641 [Vitis vinifera] 70 2e-10 ref|XP_007163101.1| hypothetical protein PHAVU_001G206300g [Phas... 70 3e-10 ref|NP_566111.1| transducin/WD-40 repeat-containing protein [Ara... 69 9e-10 gb|AFK43383.1| unknown [Medicago truncatula] 68 1e-09 ref|XP_003628455.1| hypothetical protein MTR_8g058410 [Medicago ... 68 1e-09 >ref|XP_006444303.1| hypothetical protein CICLE_v10020175mg [Citrus clementina] gi|568852542|ref|XP_006479934.1| PREDICTED: WD repeat-containing protein 89 homolog [Citrus sinensis] gi|557546565|gb|ESR57543.1| hypothetical protein CICLE_v10020175mg [Citrus clementina] Length = 389 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+S+ INRSWIS+A+VM+SPK KKNRH+PY Sbjct: 347 GGEDGRLCCWLSDDSSEINRSWISNAMVMRSPKTHKKNRHNPY 389 >ref|XP_006444302.1| hypothetical protein CICLE_v10020175mg [Citrus clementina] gi|557546564|gb|ESR57542.1| hypothetical protein CICLE_v10020175mg [Citrus clementina] Length = 441 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+S+ INRSWIS+A+VM+SPK KKNRH+PY Sbjct: 399 GGEDGRLCCWLSDDSSEINRSWISNAMVMRSPKTHKKNRHNPY 441 >ref|XP_002302707.2| transducin family protein [Populus trichocarpa] gi|550345476|gb|EEE81980.2| transducin family protein [Populus trichocarpa] Length = 384 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+ST INRSWISSALVMK K +KK RH+PY Sbjct: 342 GGEDGRLCCWLSDDSTEINRSWISSALVMKPSKARKKKRHNPY 384 >ref|XP_007050892.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508703153|gb|EOX95049.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 415 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCW+ D+S+ INRSWISSALV+KSP+ +KK+RH+PY Sbjct: 373 GGEDGRLCCWMADDSSEINRSWISSALVIKSPRNRKKSRHNPY 415 >ref|XP_002320348.2| transducin family protein [Populus trichocarpa] gi|550324066|gb|EEE98663.2| transducin family protein [Populus trichocarpa] Length = 378 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+ST INRSWISSALV KSPK +KK R PY Sbjct: 336 GGEDGRLCCWLSDDSTGINRSWISSALVKKSPKARKKKRRTPY 378 >gb|EXB36417.1| WD repeat-containing protein 89-like protein [Morus notabilis] Length = 387 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+S+ I+RSWISS LVMKSPK +KK RH PY Sbjct: 345 GGEDGRLCCWLSDDSSEIDRSWISSTLVMKSPKNRKKIRHQPY 387 >ref|XP_003521563.2| PREDICTED: WD repeat-containing protein 89 homolog [Glycine max] Length = 408 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+S+ N+SWISS L MK+ + KKNRHHPY Sbjct: 366 GGEDGRLCCWLSDDSSESNQSWISSTLTMKAERTHKKNRHHPY 408 >ref|XP_004156840.1| PREDICTED: WD repeat-containing protein 89 homolog [Cucumis sativus] Length = 391 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCW D+S +NRSWISS LV+KSP ++KNRHHPY Sbjct: 349 GGEDGRLCCWSSDDSYEMNRSWISSTLVIKSPGGRRKNRHHPY 391 >ref|XP_004152255.1| PREDICTED: WD repeat-containing protein 89 homolog [Cucumis sativus] Length = 391 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCW D+S +NRSWISS LV+KSP ++KNRHHPY Sbjct: 349 GGEDGRLCCWSSDDSYEMNRSWISSTLVIKSPGGRRKNRHHPY 391 >ref|XP_002523062.1| WD-repeat protein, putative [Ricinus communis] gi|223537624|gb|EEF39247.1| WD-repeat protein, putative [Ricinus communis] Length = 389 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D S I+RSW+SSAL M+S +KKNRHHPY Sbjct: 347 GGEDGRLCCWLSDNSARIDRSWMSSALAMRSSTSRKKNRHHPY 389 >gb|ACU19046.1| unknown [Glycine max] Length = 389 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+S N+SWISS L MK+ + KKNRHHPY Sbjct: 347 GGEDGRLCCWLSDDSFESNQSWISSTLTMKAERTHKKNRHHPY 389 >ref|XP_006840546.1| hypothetical protein AMTR_s00045p00215170 [Amborella trichopoda] gi|548842264|gb|ERN02221.1| hypothetical protein AMTR_s00045p00215170 [Amborella trichopoda] Length = 382 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/44 (70%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +3 Query: 3 GGEDGRLCCWLPDE-STAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL DE ST NRSW+S +L +KSPK +K RHHPY Sbjct: 339 GGEDGRLCCWLSDEESTETNRSWVSGSLAIKSPKSYRKRRHHPY 382 >ref|XP_004494371.1| PREDICTED: WD repeat-containing protein 89 homolog [Cicer arietinum] Length = 394 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+S N+SWISS L+MK + KKNRHHPY Sbjct: 352 GGEDGRLCCWLSDDSPQKNQSWISSTLIMKPERTCKKNRHHPY 394 >ref|XP_004290782.1| PREDICTED: WD repeat-containing protein 89 homolog [Fragaria vesca subsp. vesca] Length = 385 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +3 Query: 3 GGEDGRLCCWLPDEST-AINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D S INRSWISS LV++SPKI+K RH PY Sbjct: 342 GGEDGRLCCWLSDGSVDTINRSWISSELVLRSPKIRKSKRHSPY 385 >ref|XP_002264804.1| PREDICTED: WD repeat-containing protein 89 homolog [Vitis vinifera] Length = 388 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 32/43 (74%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCW D S NRSWISS VMKSP+ KKNRH PY Sbjct: 346 GGEDGRLCCWFSDGSPETNRSWISSEFVMKSPRTCKKNRHLPY 388 >emb|CAN75889.1| hypothetical protein VITISV_023641 [Vitis vinifera] Length = 383 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 32/43 (74%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCW D S NRSWISS VMKSP+ KKNRH PY Sbjct: 341 GGEDGRLCCWFSDGSPETNRSWISSEFVMKSPRTCKKNRHLPY 383 >ref|XP_007163101.1| hypothetical protein PHAVU_001G206300g [Phaseolus vulgaris] gi|561036565|gb|ESW35095.1| hypothetical protein PHAVU_001G206300g [Phaseolus vulgaris] Length = 386 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 3 GGEDGRLCCWLPDESTAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D S+ NRSWISS L+ + K +KKNRH PY Sbjct: 344 GGEDGRLCCWLSDHSSESNRSWISSTLITRPEKTRKKNRHQPY 386 >ref|NP_566111.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|15983390|gb|AAL11563.1|AF424569_1 At2g47790/F17A22.18 [Arabidopsis thaliana] gi|20197308|gb|AAC63654.2| expressed protein [Arabidopsis thaliana] gi|23308341|gb|AAN18140.1| At2g47790/F17A22.18 [Arabidopsis thaliana] gi|330255794|gb|AEC10888.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 392 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/44 (70%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +3 Query: 3 GGEDGRLCCWLPDE-STAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCW DE +T INRSW SS LV+K P+ +KKNRH PY Sbjct: 349 GGEDGRLCCWKSDEDATEINRSWTSSELVVKPPRNRKKNRHSPY 392 >gb|AFK43383.1| unknown [Medicago truncatula] Length = 378 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/44 (70%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +3 Query: 3 GGEDGRLCCWLPDE-STAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+ S N+SWISS+LVMK + KKNRHHPY Sbjct: 335 GGEDGRLCCWLSDDDSPQKNQSWISSSLVMKPERTCKKNRHHPY 378 >ref|XP_003628455.1| hypothetical protein MTR_8g058410 [Medicago truncatula] gi|355522477|gb|AET02931.1| hypothetical protein MTR_8g058410 [Medicago truncatula] Length = 183 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/44 (70%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +3 Query: 3 GGEDGRLCCWLPDE-STAINRSWISSALVMKSPKIQKKNRHHPY 131 GGEDGRLCCWL D+ S N+SWISS+LVMK + KKNRHHPY Sbjct: 140 GGEDGRLCCWLSDDDSPQKNQSWISSSLVMKPERTCKKNRHHPY 183