BLASTX nr result
ID: Cocculus22_contig00018397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018397 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007135365.1| hypothetical protein PHAVU_010G123300g [Phas... 55 8e-06 >ref|XP_007135365.1| hypothetical protein PHAVU_010G123300g [Phaseolus vulgaris] gi|561008410|gb|ESW07359.1| hypothetical protein PHAVU_010G123300g [Phaseolus vulgaris] Length = 469 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 275 CFCRYQREEANIQAWVNLQSAKAKAKSRKLE 367 C RYQREEA IQAWVNLQSAKA+A+SRKLE Sbjct: 365 CCLRYQREEAKIQAWVNLQSAKAEARSRKLE 395