BLASTX nr result
ID: Cocculus22_contig00018388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018388 (560 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280878.2| PREDICTED: 2-aminoethanethiol dioxygenase [V... 58 2e-06 emb|CBI21993.3| unnamed protein product [Vitis vinifera] 58 2e-06 >ref|XP_002280878.2| PREDICTED: 2-aminoethanethiol dioxygenase [Vitis vinifera] Length = 240 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 317 MPPIQKLFEQCRVSFSPNGPISEEALEKVRAML 415 MPPIQ+L+ C+ SFSPNGP+SEEALEKVR ML Sbjct: 2 MPPIQRLYNACKSSFSPNGPVSEEALEKVRTML 34 >emb|CBI21993.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 317 MPPIQKLFEQCRVSFSPNGPISEEALEKVRAML 415 MPPIQ+L+ C+ SFSPNGP+SEEALEKVR ML Sbjct: 2 MPPIQRLYNACKSSFSPNGPVSEEALEKVRTML 34