BLASTX nr result
ID: Cocculus22_contig00018358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018358 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59431.1| glutaredoxin 1 [Plantago major] 62 1e-07 ref|NP_182309.1| glutaredoxin-C13 [Arabidopsis thaliana] gi|2977... 60 3e-07 ref|XP_006410157.1| hypothetical protein EUTSA_v10017804mg [Eutr... 60 4e-07 ref|XP_006295295.1| hypothetical protein CARUB_v10024385mg [Caps... 60 4e-07 ref|XP_006397982.1| hypothetical protein EUTSA_v10001691mg [Eutr... 59 5e-07 ref|XP_007201438.1| hypothetical protein PRUPE_ppa013777mg [Prun... 59 7e-07 ref|XP_002268050.1| PREDICTED: glutaredoxin-C13 [Vitis vinifera] 59 7e-07 ref|XP_002442259.1| hypothetical protein SORBIDRAFT_08g017160 [S... 59 9e-07 ref|XP_002442257.1| hypothetical protein SORBIDRAFT_08g017120 [S... 59 9e-07 ref|XP_006296283.1| hypothetical protein CARUB_v10025453mg [Caps... 58 1e-06 ref|XP_003577277.1| PREDICTED: glutaredoxin-C10-like [Brachypodi... 58 1e-06 ref|XP_002881118.1| glutaredoxin family protein [Arabidopsis lyr... 58 1e-06 ref|NP_180612.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana... 58 1e-06 ref|XP_006304582.1| hypothetical protein CARUB_v10011626mg [Caps... 58 2e-06 ref|NP_172168.1| monothiol glutaredoxin-S11 [Arabidopsis thalian... 58 2e-06 ref|XP_002889620.1| glutaredoxin family protein [Arabidopsis lyr... 58 2e-06 ref|XP_007163065.1| hypothetical protein PHAVU_001G203200g [Phas... 57 2e-06 ref|XP_007050806.1| Glutaredoxin [Theobroma cacao] gi|508703067|... 57 2e-06 ref|XP_004494333.1| PREDICTED: monothiol glutaredoxin-S11-like [... 57 2e-06 gb|ADV56687.1| glutaredoxin [Phaseolus vulgaris] 57 2e-06 >emb|CAH59431.1| glutaredoxin 1 [Plantago major] Length = 105 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L GS+ +PAVFIGG VGSTNEVMS+HL GSL+PLLK Sbjct: 54 KALMRL----GSSGPIPAVFIGGKLVGSTNEVMSLHLSGSLIPLLK 95 >ref|NP_182309.1| glutaredoxin-C13 [Arabidopsis thaliana] gi|297790318|ref|XP_002863058.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297824893|ref|XP_002880329.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|75100580|sp|O82255.1|GRC13_ARATH RecName: Full=Glutaredoxin-C13; Short=AtGrxC13; AltName: Full=Protein ROXY 9 gi|3738300|gb|AAC63642.1| putative glutaredoxin [Arabidopsis thaliana] gi|20197557|gb|AAM15127.1| putative glutaredoxin [Arabidopsis thaliana] gi|21554200|gb|AAM63279.1| putative glutaredoxin [Arabidopsis thaliana] gi|62320234|dbj|BAD94488.1| putative glutaredoxin [Arabidopsis thaliana] gi|90962952|gb|ABE02400.1| At2g47880 [Arabidopsis thaliana] gi|226348196|gb|ACO50414.1| glutaredoxin [Arabidopsis thaliana] gi|297308864|gb|EFH39317.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297326168|gb|EFH56588.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|330255810|gb|AEC10904.1| glutaredoxin-C13 [Arabidopsis thaliana] Length = 102 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KAL+ L G + AVPAVF+GG VGSTNEVMS+HL GSLVPL+K Sbjct: 54 KALLRL----GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIK 95 >ref|XP_006410157.1| hypothetical protein EUTSA_v10017804mg [Eutrema salsugineum] gi|557111326|gb|ESQ51610.1| hypothetical protein EUTSA_v10017804mg [Eutrema salsugineum] Length = 102 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPA+F+GG VGSTNEVMSMHL GSLVPL+K Sbjct: 54 KALMRL----GCSTPVPAIFVGGKLVGSTNEVMSMHLSGSLVPLVK 95 >ref|XP_006295295.1| hypothetical protein CARUB_v10024385mg [Capsella rubella] gi|482564003|gb|EOA28193.1| hypothetical protein CARUB_v10024385mg [Capsella rubella] Length = 102 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KAL+ L G + AVPAVF+GG +GSTNEVMS+HL GSLVPL+K Sbjct: 54 KALLRL----GCSTAVPAVFVGGKLIGSTNEVMSLHLSGSLVPLIK 95 >ref|XP_006397982.1| hypothetical protein EUTSA_v10001691mg [Eutrema salsugineum] gi|557099055|gb|ESQ39435.1| hypothetical protein EUTSA_v10001691mg [Eutrema salsugineum] Length = 102 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KAL+ + G + AVPAVF+GG VGSTNEVMS+HL GSLVPL+K Sbjct: 54 KALLRI----GCSTAVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIK 95 >ref|XP_007201438.1| hypothetical protein PRUPE_ppa013777mg [Prunus persica] gi|462396838|gb|EMJ02637.1| hypothetical protein PRUPE_ppa013777mg [Prunus persica] Length = 103 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G TA VPAVFIGG VGSTNEVMS+HL G L+P LK Sbjct: 54 KALMRL----GCTAPVPAVFIGGTLVGSTNEVMSLHLKGQLIPKLK 95 >ref|XP_002268050.1| PREDICTED: glutaredoxin-C13 [Vitis vinifera] Length = 102 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KAL+ L G A VPAVFIGG VGSTNEVMS HL GSL+PLLK Sbjct: 54 KALLRL----GCNAPVPAVFIGGKLVGSTNEVMSRHLSGSLIPLLK 95 >ref|XP_002442259.1| hypothetical protein SORBIDRAFT_08g017160 [Sorghum bicolor] gi|241942952|gb|EES16097.1| hypothetical protein SORBIDRAFT_08g017160 [Sorghum bicolor] Length = 107 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLL 136 +AL+ + G +AAVPAVFIGG VG TN VMS+HL G LVP+L Sbjct: 55 RALLKMLGGGRGSAAVPAVFIGGKLVGGTNSVMSLHLAGELVPML 99 >ref|XP_002442257.1| hypothetical protein SORBIDRAFT_08g017120 [Sorghum bicolor] gi|241942950|gb|EES16095.1| hypothetical protein SORBIDRAFT_08g017120 [Sorghum bicolor] Length = 107 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLL 136 +AL+ + G +AAVPAVFIGG VG TN VMS+HL G LVP+L Sbjct: 55 RALLKMLGGGRGSAAVPAVFIGGKLVGGTNSVMSLHLAGELVPML 99 >ref|XP_006296283.1| hypothetical protein CARUB_v10025453mg [Capsella rubella] gi|482564991|gb|EOA29181.1| hypothetical protein CARUB_v10025453mg [Capsella rubella] Length = 102 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPA+F+GG +GSTNEVMS+HL GSLVPL+K Sbjct: 54 KALMRL----GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVK 95 >ref|XP_003577277.1| PREDICTED: glutaredoxin-C10-like [Brachypodium distachyon] Length = 105 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +2 Query: 11 MALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 +A G GST+ VPAVFIGG VG TN VM++HL G LVP+LK Sbjct: 56 LARRLGRGSTSVVPAVFIGGNLVGGTNRVMALHLAGQLVPMLK 98 >ref|XP_002881118.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297326957|gb|EFH57377.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] Length = 102 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPA+F+GG +GSTNEVMS+HL GSLVPL+K Sbjct: 54 KALMRL----GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVK 95 >ref|NP_180612.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana] gi|75317810|sp|O04341.1|GRXS9_ARATH RecName: Full=Monothiol glutaredoxin-S9; Short=AtGrxS9; AltName: Full=Protein ROXY 7 gi|1946365|gb|AAB63083.1| putative glutaredoxin [Arabidopsis thaliana] gi|21593494|gb|AAM65461.1| putative glutaredoxin [Arabidopsis thaliana] gi|22022556|gb|AAM83235.1| At2g30540/T6B20.11 [Arabidopsis thaliana] gi|24111317|gb|AAN46782.1| At2g30540/T6B20.11 [Arabidopsis thaliana] gi|226348192|gb|ACO50412.1| glutaredoxin [Arabidopsis thaliana] gi|330253311|gb|AEC08405.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana] Length = 102 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPA+F+GG +GSTNEVMS+HL GSLVPL+K Sbjct: 54 KALMRL----GCSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVK 95 >ref|XP_006304582.1| hypothetical protein CARUB_v10011626mg [Capsella rubella] gi|482573293|gb|EOA37480.1| hypothetical protein CARUB_v10011626mg [Capsella rubella] Length = 99 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPAVFIGG VGSTNEVMSMHL SLVPL+K Sbjct: 54 KALMRL----GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVK 95 >ref|NP_172168.1| monothiol glutaredoxin-S11 [Arabidopsis thaliana] gi|75191726|sp|Q9M9Y9.1|GRS11_ARATH RecName: Full=Monothiol glutaredoxin-S11; Short=AtGrxS11; AltName: Full=Protein ROXY 6 gi|7523711|gb|AAF63150.1|AC011001_20 Similar to glutaredoxin [Arabidopsis thaliana] gi|18252863|gb|AAL62358.1| glutaredoxin, putative [Arabidopsis thaliana] gi|21387059|gb|AAM47933.1| putative glutaredoxin [Arabidopsis thaliana] gi|21537263|gb|AAM61604.1| glutaredoxin, putative [Arabidopsis thaliana] gi|226348190|gb|ACO50411.1| glutaredoxin [Arabidopsis thaliana] gi|332189922|gb|AEE28043.1| monothiol glutaredoxin-S11 [Arabidopsis thaliana] Length = 99 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPAVFIGG VGSTNEVMSMHL SLVPL+K Sbjct: 54 KALMRL----GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVK 95 >ref|XP_002889620.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297335462|gb|EFH65879.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] Length = 99 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G + VPAVFIGG VGSTNEVMSMHL SLVPL+K Sbjct: 54 KALMRL----GCSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVK 95 >ref|XP_007163065.1| hypothetical protein PHAVU_001G203200g [Phaseolus vulgaris] gi|561036529|gb|ESW35059.1| hypothetical protein PHAVU_001G203200g [Phaseolus vulgaris] Length = 97 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KAL+ L G A VPAVFIGG +GSTNE+MS+HL GSL PLLK Sbjct: 54 KALLRL----GCNAPVPAVFIGGKLIGSTNEIMSLHLRGSLTPLLK 95 >ref|XP_007050806.1| Glutaredoxin [Theobroma cacao] gi|508703067|gb|EOX94963.1| Glutaredoxin [Theobroma cacao] Length = 100 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 32 GSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 G A VPAVFIGG VGSTNEVMS+HL G L+PLLK Sbjct: 60 GCNAPVPAVFIGGKLVGSTNEVMSLHLSGGLIPLLK 95 >ref|XP_004494333.1| PREDICTED: monothiol glutaredoxin-S11-like [Cicer arietinum] Length = 102 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KALM L G TA VPAVFIGG +GSTNE+MS+HL GSL LLK Sbjct: 54 KALMRL----GCTAPVPAVFIGGKLMGSTNEIMSLHLSGSLTQLLK 95 >gb|ADV56687.1| glutaredoxin [Phaseolus vulgaris] Length = 145 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 2 KALMALAAGSGSTAAVPAVFIGGAFVGSTNEVMSMHLCGSLVPLLK 139 KAL+ L G A VPAVFIGG +GSTNE+MS+HL GSL PLLK Sbjct: 102 KALLRL----GCNAPVPAVFIGGKLIGSTNEIMSLHLRGSLTPLLK 143