BLASTX nr result
ID: Cocculus22_contig00018100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00018100 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19252.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002283885.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 80 3e-13 emb|CAN74012.1| hypothetical protein VITISV_003549 [Vitis vinifera] 80 3e-13 ref|XP_002307344.2| hypothetical protein POPTR_0005s17820g [Popu... 80 4e-13 ref|XP_002301091.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protei... 79 5e-13 ref|XP_002514028.1| conserved hypothetical protein [Ricinus comm... 79 5e-13 ref|XP_004289526.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 77 2e-12 ref|XP_003615274.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 77 2e-12 ref|XP_003602929.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 77 2e-12 gb|EXC16662.1| Ubiquitin carboxyl-terminal hydrolase 16 [Morus n... 75 7e-12 ref|XP_006578260.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_006578259.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_006338134.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_004973705.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_004973704.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_004490438.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_003523774.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 75 1e-11 ref|XP_007137649.1| hypothetical protein PHAVU_009G144200g [Phas... 74 2e-11 ref|XP_007208087.1| hypothetical protein PRUPE_ppa001429mg [Prun... 74 2e-11 ref|XP_004501631.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 74 3e-11 >emb|CBI19252.3| unnamed protein product [Vitis vinifera] Length = 841 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFKIDDS VKPVEL+RVL+KGAYMLLYARCSPRAP L+R+ I K++ S + Sbjct: 746 KWFKIDDSTVKPVELERVLTKGAYMLLYARCSPRAPRLIRNAVIPRNRKLEAASSRNIVK 805 Query: 79 TTS 71 T+ Sbjct: 806 NTT 808 >ref|XP_002283885.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Vitis vinifera] Length = 1213 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFKIDDS VKPVEL+RVL+KGAYMLLYARCSPRAP L+R+ I K++ S + Sbjct: 924 KWFKIDDSTVKPVELERVLTKGAYMLLYARCSPRAPRLIRNAVIPRNRKLEAASSRNIVK 983 Query: 79 TTS 71 T+ Sbjct: 984 NTT 986 >emb|CAN74012.1| hypothetical protein VITISV_003549 [Vitis vinifera] Length = 1225 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFKIDDS VKPVEL+RVL+KGAYMLLYARCSPRAP L+R+ I K++ S + Sbjct: 936 KWFKIDDSTVKPVELERVLTKGAYMLLYARCSPRAPRLIRNAVIPRNRKLEAASSRNIVK 995 Query: 79 TTS 71 T+ Sbjct: 996 NTT 998 >ref|XP_002307344.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa] gi|550339194|gb|EEE94340.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa] Length = 1125 Score = 79.7 bits (195), Expect = 4e-13 Identities = 41/69 (59%), Positives = 47/69 (68%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFKIDDS V VEL+RVLSKGAYMLLYARCSPRAP +R IS+ K K S + Sbjct: 866 KWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAPRSIRSRIISSDPKNKCYTSKINAT 925 Query: 79 TTSCDRKGT 53 T+ D + T Sbjct: 926 NTALDSRST 934 >ref|XP_002301091.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa] gi|550344706|gb|EEE80364.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa] Length = 1141 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/67 (59%), Positives = 48/67 (71%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFKIDDS V VEL+RVLSKGAYMLLYARCSPRAP L+R IS+ K K S ++ Sbjct: 878 KWFKIDDSTVTAVELERVLSKGAYMLLYARCSPRAPRLIRSRIISSDPKNKCSPSKIKAT 937 Query: 79 TTSCDRK 59 T+ + + Sbjct: 938 NTALNSR 944 >ref|XP_002514028.1| conserved hypothetical protein [Ricinus communis] gi|223547114|gb|EEF48611.1| conserved hypothetical protein [Ricinus communis] Length = 1060 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFKIDDS V VEL+RVL+KGAYMLLYARCSPRAP L+R+ S+ K+K S V Sbjct: 798 KWFKIDDSTVTAVELERVLTKGAYMLLYARCSPRAPRLIRNRIASSDPKMKGSASRVSAK 857 Query: 79 TTSCDRKGT 53 T+ + + + Sbjct: 858 NTALNSRSS 866 >ref|XP_004289526.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Fragaria vesca subsp. vesca] Length = 860 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/82 (50%), Positives = 53/82 (64%), Gaps = 1/82 (1%) Frame = -1 Query: 262 GKWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISN-GCKIKQDRSSVQ 86 G WFKIDDS V+PVEL RVLS+GAYMLLYAR SPR+P L+ T+S G +++ +V Sbjct: 647 GNWFKIDDSSVEPVELKRVLSEGAYMLLYARRSPRSPPLVGSNTVSQAGSSNRRNSEAVP 706 Query: 85 IHTTSCDRKGTIPRRRSTSAVP 20 T + T+P S +A P Sbjct: 707 SSLTKSKLRSTVPSMISCAAQP 728 >ref|XP_003615274.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355516609|gb|AES98232.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 1050 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/79 (53%), Positives = 52/79 (65%), Gaps = 3/79 (3%) Frame = -1 Query: 256 WFKIDDS--RVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIK-QDRSSVQ 86 WFK+DDS RV PVEL+ VL+KGAYMLLYARCSPRAP L+RD +S+ K K +S + Sbjct: 817 WFKVDDSVVRVTPVELETVLTKGAYMLLYARCSPRAPRLIRDMIVSSDSKSKVNGKSVIM 876 Query: 85 IHTTSCDRKGTIPRRRSTS 29 H + G+ R S S Sbjct: 877 KHKHASSHSGSAERIMSNS 895 >ref|XP_003602929.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355491977|gb|AES73180.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 1116 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/77 (50%), Positives = 49/77 (63%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFK+DDS V VEL+RVL+KGAYML YARCSPRAP L+R+ +S K + S + Sbjct: 859 KWFKVDDSVVTAVELERVLTKGAYMLFYARCSPRAPKLIRNRILSQDSNSKVNGKSTKAR 918 Query: 79 TTSCDRKGTIPRRRSTS 29 +TS + P S S Sbjct: 919 STSSNSGAAEPISSSVS 935 >gb|EXC16662.1| Ubiquitin carboxyl-terminal hydrolase 16 [Morus notabilis] Length = 1038 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIK 107 KWFKIDDS V PV+L++VLSKGAYML YARCSPRAP L+R+ +S+ K + Sbjct: 879 KWFKIDDSTVTPVDLEKVLSKGAYMLFYARCSPRAPRLIRNRIVSSDPKAR 929 >ref|XP_006578260.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform X3 [Glycine max] Length = 1080 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/80 (47%), Positives = 48/80 (60%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFK+DDS V VELDRVL+KGAYML YARCSPRAP L+R+ +S K K ++ Sbjct: 878 KWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIRNRILSPDSKRKVSGKTLTTK 937 Query: 79 TTSCDRKGTIPRRRSTSAVP 20 S + ++S P Sbjct: 938 ARSISTNSGVAEHVNSSISP 957 >ref|XP_006578259.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform X2 [Glycine max] Length = 1138 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/80 (47%), Positives = 48/80 (60%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFK+DDS V VELDRVL+KGAYML YARCSPRAP L+R+ +S K K ++ Sbjct: 878 KWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIRNRILSPDSKRKVSGKTLTTK 937 Query: 79 TTSCDRKGTIPRRRSTSAVP 20 S + ++S P Sbjct: 938 ARSISTNSGVAEHVNSSISP 957 >ref|XP_006338134.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Solanum tuberosum] Length = 1165 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/64 (59%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETI-SNGCKIKQDRSSVQI 83 KW+K+DDS VK VEL+RVLSKGAYMLLY+RCSPR P +MR TI + + KQ + Sbjct: 902 KWYKVDDSSVKSVELERVLSKGAYMLLYSRCSPRGPRIMRSLTIPRDPRRSKQPTCKSRS 961 Query: 82 HTTS 71 HT S Sbjct: 962 HTRS 965 >ref|XP_004973705.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform X2 [Setaria italica] Length = 978 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/58 (60%), Positives = 43/58 (74%) Frame = -1 Query: 262 GKWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSV 89 GKWFK DDS+VKPV LD V+SK AYMLLYARCSPRAPS +R + + + K+ + V Sbjct: 720 GKWFKADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRKVMVQDPARPKKAKQKV 777 >ref|XP_004973704.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform X1 [Setaria italica] Length = 993 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/58 (60%), Positives = 43/58 (74%) Frame = -1 Query: 262 GKWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSV 89 GKWFK DDS+VKPV LD V+SK AYMLLYARCSPRAPS +R + + + K+ + V Sbjct: 735 GKWFKADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVRKVMVQDPARPKKAKQKV 792 >ref|XP_004490438.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer arietinum] Length = 940 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/65 (55%), Positives = 48/65 (73%), Gaps = 3/65 (4%) Frame = -1 Query: 256 WFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQI-- 83 WFK+DDS V PVEL+ VL++GAYML YARCSPRAP L+RD +S+ K K + ++ + Sbjct: 709 WFKVDDSVVMPVELETVLTRGAYMLFYARCSPRAPRLIRDMIVSSDSKSKVNGKTITMKY 768 Query: 82 -HTTS 71 HT+S Sbjct: 769 KHTSS 773 >ref|XP_003523774.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform X1 [Glycine max] Length = 1063 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/80 (47%), Positives = 48/80 (60%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSVQIH 80 KWFK+DDS V VELDRVL+KGAYML YARCSPRAP L+R+ +S K K ++ Sbjct: 878 KWFKVDDSVVTAVELDRVLTKGAYMLFYARCSPRAPRLIRNRILSPDSKRKVSGKTLTTK 937 Query: 79 TTSCDRKGTIPRRRSTSAVP 20 S + ++S P Sbjct: 938 ARSISTNSGVAEHVNSSISP 957 >ref|XP_007137649.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris] gi|561010736|gb|ESW09643.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris] Length = 1125 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIK 107 +WFK+DDS V VEL+RVL+KGAYMLLYARCSPRAP L+R+ +S+ K K Sbjct: 866 RWFKVDDSVVTAVELERVLTKGAYMLLYARCSPRAPRLIRNRILSSDSKSK 916 >ref|XP_007208087.1| hypothetical protein PRUPE_ppa001429mg [Prunus persica] gi|462403729|gb|EMJ09286.1| hypothetical protein PRUPE_ppa001429mg [Prunus persica] Length = 830 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 2/73 (2%) Frame = -1 Query: 262 GKWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSV-- 89 G+WFKIDDS V+PV+L RVLS+GAYMLLYAR +PR P+ + +SNG K+K+ Sbjct: 648 GEWFKIDDSSVEPVDLKRVLSQGAYMLLYARRTPRPPAFLGSTAVSNGEKLKRRNLEAVP 707 Query: 88 QIHTTSCDRKGTI 50 HT S R ++ Sbjct: 708 SSHTKSKSRSNSV 720 >ref|XP_004501631.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer arietinum] Length = 1129 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -1 Query: 259 KWFKIDDSRVKPVELDRVLSKGAYMLLYARCSPRAPSLMRDETISNGCKIKQDRSSV 89 KWFK+DDS V VEL+RVL+KGAYML YARCSPRAP L+R+ +S K K + S+ Sbjct: 862 KWFKVDDSVVTAVELERVLTKGAYMLFYARCSPRAPKLIRNRILSPDSKSKVNGKSL 918