BLASTX nr result
ID: Cocculus22_contig00017983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00017983 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274665.1| PREDICTED: uncharacterized protein LOC100249... 57 3e-06 emb|CBI30984.3| unnamed protein product [Vitis vinifera] 57 3e-06 >ref|XP_002274665.1| PREDICTED: uncharacterized protein LOC100249833 [Vitis vinifera] Length = 652 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 1 LNSVQLSQDMMMNTLEKCLPNVFQALERFSSECVQAFETIHGCDK 135 LNSVQ+SQ M +N L+ LPNVFQAL FSS C QAFE +H K Sbjct: 603 LNSVQVSQAMTVNNLQTSLPNVFQALMGFSSVCAQAFEAVHSYAK 647 >emb|CBI30984.3| unnamed protein product [Vitis vinifera] Length = 632 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 1 LNSVQLSQDMMMNTLEKCLPNVFQALERFSSECVQAFETIHGCDK 135 LNSVQ+SQ M +N L+ LPNVFQAL FSS C QAFE +H K Sbjct: 583 LNSVQVSQAMTVNNLQTSLPNVFQALMGFSSVCAQAFEAVHSYAK 627