BLASTX nr result
ID: Cocculus22_contig00014747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014747 (929 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208117.1| hypothetical protein PRUPE_ppa000687mg [Prun... 60 1e-06 ref|XP_004302405.1| PREDICTED: uncharacterized protein LOC101313... 57 8e-06 >ref|XP_007208117.1| hypothetical protein PRUPE_ppa000687mg [Prunus persica] gi|462403759|gb|EMJ09316.1| hypothetical protein PRUPE_ppa000687mg [Prunus persica] Length = 1036 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 619 IDISHQMLSLLVRCNDIVMDVKSNLGYVPYHPL 521 +DISHQMLSLL RCND+V +VK LGYVPYHPL Sbjct: 1004 VDISHQMLSLLTRCNDVVANVKGLLGYVPYHPL 1036 >ref|XP_004302405.1| PREDICTED: uncharacterized protein LOC101313815 [Fragaria vesca subsp. vesca] Length = 1167 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 619 IDISHQMLSLLVRCNDIVMDVKSNLGYVPYHPL 521 +DIS QMLSLL RCND+V +VK LGYVPYHPL Sbjct: 1135 VDISQQMLSLLTRCNDVVTNVKGYLGYVPYHPL 1167