BLASTX nr result
ID: Cocculus22_contig00014654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014654 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein ... 63 4e-08 ref|XP_006378175.1| hypothetical protein POPTR_0010s04480g [Popu... 62 1e-07 ref|XP_002520165.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_006483271.1| PREDICTED: tetratricopeptide repeat protein ... 59 7e-07 ref|XP_006483270.1| PREDICTED: tetratricopeptide repeat protein ... 59 7e-07 ref|XP_006438546.1| hypothetical protein CICLE_v10031073mg [Citr... 59 7e-07 ref|XP_007222940.1| hypothetical protein PRUPE_ppa005300mg [Prun... 59 9e-07 ref|XP_007044398.1| Tetratricopeptide repeat (TPR)-like superfam... 58 1e-06 ref|XP_007044397.1| Tetratricopeptide repeat (TPR)-like superfam... 58 1e-06 tpg|DAA50757.1| TPA: hypothetical protein ZEAMMB73_168428 [Zea m... 57 2e-06 ref|NP_001144123.1| uncharacterized protein LOC100276965 [Zea ma... 57 2e-06 ref|XP_004300631.1| PREDICTED: tetratricopeptide repeat protein ... 56 5e-06 >ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein 38 [Vitis vinifera] gi|296086448|emb|CBI32037.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 +QV+ R G+PFLWRLLERGYSM G+Q+A A ++A ALE +YF Sbjct: 425 KQVKNREGVPFLWRLLERGYSMTGKQEARVAGEKAMALETSYF 467 >ref|XP_006378175.1| hypothetical protein POPTR_0010s04480g [Populus trichocarpa] gi|550329046|gb|ERP55972.1| hypothetical protein POPTR_0010s04480g [Populus trichocarpa] Length = 472 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 +Q++KR G PF+WRLLERGY+M G Q+AT A ++A ALE A+F Sbjct: 426 KQIKKREGTPFMWRLLERGYAMTGSQEATVAGEKARALEAAHF 468 >ref|XP_002520165.1| conserved hypothetical protein [Ricinus communis] gi|223540657|gb|EEF42220.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -2 Query: 359 QVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 Q++KR G PF+WRLLE+GY+M GR +A A ++A ALE AYF Sbjct: 411 QIKKREGAPFMWRLLEKGYAMTGRHEAKVAGEKAKALESAYF 452 >ref|XP_006483271.1| PREDICTED: tetratricopeptide repeat protein 38-like isoform X2 [Citrus sinensis] Length = 414 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 ++++KR G PFLWRLLER YSM GRQ+A +++A LE AYF Sbjct: 371 KRIKKREGAPFLWRLLERAYSMVGRQEAAAVSEKARTLEAAYF 413 >ref|XP_006483270.1| PREDICTED: tetratricopeptide repeat protein 38-like isoform X1 [Citrus sinensis] Length = 467 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 ++++KR G PFLWRLLER YSM GRQ+A +++A LE AYF Sbjct: 424 KRIKKREGAPFLWRLLERAYSMVGRQEAAAVSEKARTLEAAYF 466 >ref|XP_006438546.1| hypothetical protein CICLE_v10031073mg [Citrus clementina] gi|557540742|gb|ESR51786.1| hypothetical protein CICLE_v10031073mg [Citrus clementina] Length = 467 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 ++++KR G PFLWRLLER YSM GRQ+A +++A LE AYF Sbjct: 424 KRIKKREGAPFLWRLLERAYSMVGRQEAAAVSEKARTLEAAYF 466 >ref|XP_007222940.1| hypothetical protein PRUPE_ppa005300mg [Prunus persica] gi|462419876|gb|EMJ24139.1| hypothetical protein PRUPE_ppa005300mg [Prunus persica] Length = 468 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 ++++ R GIPFLWRLLERGY + GR++A A+ +A LE AYF Sbjct: 425 KRIKTREGIPFLWRLLERGYKLTGREEAAIASAKAKLLETAYF 467 >ref|XP_007044398.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] gi|508708333|gb|EOY00230.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] Length = 470 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 +Q++KR G PFLWRLLE GY+++GRQ+A ++A LE AYF Sbjct: 427 KQIQKREGAPFLWRLLETGYTLSGRQEAATIGEKARVLEAAYF 469 >ref|XP_007044397.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508708332|gb|EOY00229.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 467 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 +Q++KR G PFLWRLLE GY+++GRQ+A ++A LE AYF Sbjct: 424 KQIQKREGAPFLWRLLETGYTLSGRQEAATIGEKARVLEAAYF 466 >tpg|DAA50757.1| TPA: hypothetical protein ZEAMMB73_168428 [Zea mays] Length = 473 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/44 (59%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQ-DATFAAKQASALEVAYF 234 +Q+ KR G PFLWRLLE+ YS+AGR DA+ A+K+A+AL+ +YF Sbjct: 429 KQIRKREGAPFLWRLLEKSYSLAGRSADASVASKKANALQSSYF 472 >ref|NP_001144123.1| uncharacterized protein LOC100276965 [Zea mays] gi|195637196|gb|ACG38066.1| hypothetical protein [Zea mays] Length = 443 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/44 (59%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQ-DATFAAKQASALEVAYF 234 +Q+ KR G PFLWRLLE+ YS+AGR DA+ A+K+A+AL+ +YF Sbjct: 399 KQIRKREGAPFLWRLLEKSYSLAGRSADASVASKKANALQSSYF 442 >ref|XP_004300631.1| PREDICTED: tetratricopeptide repeat protein 38-like [Fragaria vesca subsp. vesca] Length = 469 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = -2 Query: 362 RQVEKRNGIPFLWRLLERGYSMAGRQDATFAAKQASALEVAYF 234 ++++ R+GIPFLWRLLERGY GR + A+++A LE AYF Sbjct: 426 KRIKARDGIPFLWRLLERGYKQTGRPEVAIASEKARGLETAYF 468