BLASTX nr result
ID: Cocculus22_contig00014614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014614 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006603695.1| PREDICTED: uncharacterized protein LOC100777... 56 7e-06 >ref|XP_006603695.1| PREDICTED: uncharacterized protein LOC100777968 isoform X1 [Glycine max] Length = 478 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +1 Query: 154 IFVSLQSLLFTVMSYMGKLRIVVKSERGFIDSQLIISCLKEAFKKICEAASRV 312 I LQSL T+MSYMGK+RI E+ FID QL SCL+ + + I EAA ++ Sbjct: 424 ILTELQSLTMTIMSYMGKIRIAFGVEKNFIDKQLFKSCLENSLEMIKEAAKKI 476