BLASTX nr result
ID: Cocculus22_contig00014552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014552 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME83575.1| hypothetical protein MYCFIDRAFT_72197 [Pseudocerc... 125 8e-27 gb|EME46929.1| hypothetical protein DOTSEDRAFT_70763 [Dothistrom... 122 4e-26 ref|XP_003857745.1| hypothetical protein MYCGRDRAFT_102019 [Zymo... 121 9e-26 gb|EMF14317.1| bax inhibitor family protein [Sphaerulina musiva ... 120 3e-25 ref|XP_001560065.1| hypothetical protein BC1G_01624 [Botryotinia... 114 1e-23 ref|XP_001592917.1| hypothetical protein SS1G_05839 [Sclerotinia... 112 5e-23 ref|XP_007600623.1| bax Inhibitor family protein [Colletotrichum... 110 2e-22 gb|EPE30737.1| hypothetical protein GLAREA_03704 [Glarea lozoyen... 110 2e-22 emb|CCF38384.1| bax Inhibitor family protein [Colletotrichum hig... 109 4e-22 gb|ESZ98757.1| Bax Inhibitor family protein [Sclerotinia boreali... 109 5e-22 gb|EQB58927.1| bax Inhibitor family protein [Colletotrichum gloe... 108 8e-22 gb|ENH79125.1| bax inhibitor family protein [Colletotrichum orbi... 108 8e-22 ref|XP_007276123.1| bax inhibitor family protein [Colletotrichum... 108 8e-22 gb|EHK96298.1| putative peptide methionine sulfoxide reductase [... 108 8e-22 ref|XP_001265886.1| Bax Inhibitor family protein [Neosartorya fi... 108 1e-21 ref|XP_749457.1| Bax Inhibitor family protein [Aspergillus fumig... 107 2e-21 ref|XP_001823999.1| bax Inhibitor family protein [Aspergillus or... 107 2e-21 emb|CCU81440.1| bax Inhibitor family protein [Blumeria graminis ... 106 3e-21 gb|EPQ65260.1| hypothetical protein BGT96224_960 [Blumeria grami... 106 3e-21 gb|EPE09791.1| bax inhibitor family protein [Ophiostoma piceae U... 106 3e-21 >gb|EME83575.1| hypothetical protein MYCFIDRAFT_72197 [Pseudocercospora fijiensis CIRAD86] Length = 344 Score = 125 bits (313), Expect = 8e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG Sbjct: 282 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 341 Query: 145 RRK 137 RRK Sbjct: 342 RRK 344 >gb|EME46929.1| hypothetical protein DOTSEDRAFT_70763 [Dothistroma septosporum NZE10] Length = 229 Score = 122 bits (307), Expect = 4e-26 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYDTQKILAHARMAERGMF+RDAVNESI+LELDFINIFVRMVQILAMQQG Sbjct: 167 GGLAVFGGFTLYDTQKILAHARMAERGMFKRDAVNESISLELDFINIFVRMVQILAMQQG 226 Query: 145 RRK 137 RRK Sbjct: 227 RRK 229 >ref|XP_003857745.1| hypothetical protein MYCGRDRAFT_102019 [Zymoseptoria tritici IPO323] gi|339477630|gb|EGP92721.1| hypothetical protein MYCGRDRAFT_102019 [Zymoseptoria tritici IPO323] Length = 348 Score = 121 bits (304), Expect = 9e-26 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYDTQKILAHARMAERG FRRDAVNESI+LELDFINIFVRMVQILAMQQG Sbjct: 286 GGLAVFGGFTLYDTQKILAHARMAERGAFRRDAVNESISLELDFINIFVRMVQILAMQQG 345 Query: 145 RRK 137 RRK Sbjct: 346 RRK 348 >gb|EMF14317.1| bax inhibitor family protein [Sphaerulina musiva SO2202] Length = 350 Score = 120 bits (300), Expect = 3e-25 Identities = 60/63 (95%), Positives = 62/63 (98%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYDTQKILAHARMAE+G FR+DAVNESIALELDFINIFVRMVQILAMQQG Sbjct: 288 GGLAVFGGFTLYDTQKILAHARMAEQGRFRKDAVNESIALELDFINIFVRMVQILAMQQG 347 Query: 145 RRK 137 RRK Sbjct: 348 RRK 350 >ref|XP_001560065.1| hypothetical protein BC1G_01624 [Botryotinia fuckeliana B05.10] gi|347831000|emb|CCD46697.1| similar to bax inhibitor family protein [Botryotinia fuckeliana T4] gi|472244831|gb|EMR89433.1| putative bax inhibitor family protein [Botryotinia fuckeliana BcDW1] Length = 340 Score = 114 bits (285), Expect = 1e-23 Identities = 56/63 (88%), Positives = 59/63 (93%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKILAHARMAERGM RRDAVNESI+LELDF+NIF+RMVQIL MQQ Sbjct: 278 GGLAVFGGFTLYDVQKILAHARMAERGMMRRDAVNESISLELDFLNIFIRMVQILMMQQN 337 Query: 145 RRK 137 RRK Sbjct: 338 RRK 340 >ref|XP_001592917.1| hypothetical protein SS1G_05839 [Sclerotinia sclerotiorum 1980] gi|154703619|gb|EDO03358.1| hypothetical protein SS1G_05839 [Sclerotinia sclerotiorum 1980 UF-70] Length = 340 Score = 112 bits (280), Expect = 5e-23 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKILAHARMAERGM RRDAVNESI+LELDF+NIF+RMVQIL MQ Sbjct: 278 GGLAVFGGFTLYDVQKILAHARMAERGMMRRDAVNESISLELDFLNIFIRMVQILMMQNN 337 Query: 145 RRK 137 RRK Sbjct: 338 RRK 340 >ref|XP_007600623.1| bax Inhibitor family protein [Colletotrichum fioriniae PJ7] gi|588893619|gb|EXF75731.1| bax Inhibitor family protein [Colletotrichum fioriniae PJ7] Length = 337 Score = 110 bits (275), Expect = 2e-22 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HAR+AERG+ R+DAVNESIALELDFINIFVRMVQIL MQQ Sbjct: 275 GGLAVFGGFTLYDVQKILHHARLAERGIIRKDAVNESIALELDFINIFVRMVQILMMQQN 334 Query: 145 RRK 137 RRK Sbjct: 335 RRK 337 >gb|EPE30737.1| hypothetical protein GLAREA_03704 [Glarea lozoyensis ATCC 20868] Length = 340 Score = 110 bits (275), Expect = 2e-22 Identities = 52/63 (82%), Positives = 60/63 (95%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKILAHARMA++G+ R+DAVNES++LELDF+NIF+RMVQIL MQQG Sbjct: 278 GGLAVFGGFTLYDVQKILAHARMAQQGLIRKDAVNESMSLELDFLNIFIRMVQILMMQQG 337 Query: 145 RRK 137 RRK Sbjct: 338 RRK 340 >emb|CCF38384.1| bax Inhibitor family protein [Colletotrichum higginsianum] Length = 349 Score = 109 bits (273), Expect = 4e-22 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HAR+AERG+ R+DAVNESIALELDFINIFVRMVQIL MQQ Sbjct: 287 GGLAVFGGFTLYDVQKILHHARLAERGVIRKDAVNESIALELDFINIFVRMVQILTMQQN 346 Query: 145 RRK 137 RR+ Sbjct: 347 RRR 349 >gb|ESZ98757.1| Bax Inhibitor family protein [Sclerotinia borealis F-4157] Length = 338 Score = 109 bits (272), Expect = 5e-22 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKILAHARMAERGM RRDAVNESI+LELDF+NIF+RMVQIL MQQ Sbjct: 277 GGLAVFGGFTLYDVQKILAHARMAERGMMRRDAVNESISLELDFLNIFIRMVQILMMQQR 336 Query: 145 RR 140 ++ Sbjct: 337 KK 338 >gb|EQB58927.1| bax Inhibitor family protein [Colletotrichum gloeosporioides Cg-14] Length = 335 Score = 108 bits (270), Expect = 8e-22 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HAR+AERG+ R+DAVNESIALELDFINIFVRMVQIL MQ Sbjct: 273 GGLAVFGGFTLYDVQKILHHARLAERGVIRKDAVNESIALELDFINIFVRMVQILMMQNN 332 Query: 145 RRK 137 RRK Sbjct: 333 RRK 335 >gb|ENH79125.1| bax inhibitor family protein [Colletotrichum orbiculare MAFF 240422] Length = 336 Score = 108 bits (270), Expect = 8e-22 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HAR+AERG+ R+DAVNESIALELDFINIFVRMVQIL MQ Sbjct: 274 GGLAVFGGFTLYDVQKILHHARLAERGVIRKDAVNESIALELDFINIFVRMVQILMMQNN 333 Query: 145 RRK 137 RRK Sbjct: 334 RRK 336 >ref|XP_007276123.1| bax inhibitor family protein [Colletotrichum gloeosporioides Nara gc5] gi|429860071|gb|ELA34822.1| bax inhibitor family protein [Colletotrichum gloeosporioides Nara gc5] Length = 316 Score = 108 bits (270), Expect = 8e-22 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HAR+AERG+ R+DAVNESIALELDFINIFVRMVQIL MQ Sbjct: 254 GGLAVFGGFTLYDVQKILHHARLAERGVIRKDAVNESIALELDFINIFVRMVQILMMQNN 313 Query: 145 RRK 137 RRK Sbjct: 314 RRK 316 >gb|EHK96298.1| putative peptide methionine sulfoxide reductase [Glarea lozoyensis 74030] Length = 537 Score = 108 bits (270), Expect = 8e-22 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKILAHARMA++G+ R+DAVNES++LELDF+NIF+RMVQIL MQQG Sbjct: 278 GGLAVFGGFTLYDVQKILAHARMAQQGLIRKDAVNESMSLELDFLNIFIRMVQILMMQQG 337 Query: 145 RR 140 RR Sbjct: 338 RR 339 >ref|XP_001265886.1| Bax Inhibitor family protein [Neosartorya fischeri NRRL 181] gi|119414050|gb|EAW23989.1| Bax Inhibitor family protein [Neosartorya fischeri NRRL 181] Length = 337 Score = 108 bits (269), Expect = 1e-21 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HARMAERG+ RRD VNESI+LELDFINIFVRMVQILAMQ+ Sbjct: 275 GGLAVFGGFTLYDIQKILHHARMAERGLVRRDVVNESISLELDFINIFVRMVQILAMQRN 334 Query: 145 RRK 137 RK Sbjct: 335 NRK 337 >ref|XP_749457.1| Bax Inhibitor family protein [Aspergillus fumigatus Af293] gi|66847088|gb|EAL87419.1| Bax Inhibitor family protein [Aspergillus fumigatus Af293] gi|159128869|gb|EDP53983.1| Bax Inhibitor family protein [Aspergillus fumigatus A1163] Length = 337 Score = 107 bits (267), Expect = 2e-21 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QKIL HAR+AERG+ RRD VNESI+LELDFINIFVRMVQILAMQ+ Sbjct: 275 GGLAVFGGFTLYDVQKILHHARLAERGLVRRDVVNESISLELDFINIFVRMVQILAMQRN 334 Query: 145 RRK 137 RK Sbjct: 335 NRK 337 >ref|XP_001823999.1| bax Inhibitor family protein [Aspergillus oryzae RIB40] gi|238499671|ref|XP_002381070.1| Bax Inhibitor family protein [Aspergillus flavus NRRL3357] gi|83772738|dbj|BAE62866.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220692823|gb|EED49169.1| Bax Inhibitor family protein [Aspergillus flavus NRRL3357] gi|391869368|gb|EIT78567.1| growth hormone-induced protein [Aspergillus oryzae 3.042] Length = 337 Score = 107 bits (266), Expect = 2e-21 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QK+L H+RMAERG+ RRD VNESI+LELDFINIF+RMVQILAMQ+ Sbjct: 275 GGLAVFGGFTLYDVQKVLHHSRMAERGLIRRDVVNESISLELDFINIFIRMVQILAMQRN 334 Query: 145 RRK 137 RK Sbjct: 335 NRK 337 >emb|CCU81440.1| bax Inhibitor family protein [Blumeria graminis f. sp. hordei DH14] Length = 336 Score = 106 bits (265), Expect = 3e-21 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QK+L HARMA+RG+ +RD VNESI+LELDF+NIFVRMVQIL MQQ Sbjct: 274 GGLAVFGGFTLYDVQKVLMHARMAQRGLLQRDPVNESISLELDFLNIFVRMVQILMMQQS 333 Query: 145 RRK 137 RRK Sbjct: 334 RRK 336 >gb|EPQ65260.1| hypothetical protein BGT96224_960 [Blumeria graminis f. sp. tritici 96224] Length = 336 Score = 106 bits (265), Expect = 3e-21 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QK+L HARMA+RG+ +RD VNESI+LELDF+NIFVRMVQIL MQQ Sbjct: 274 GGLAVFGGFTLYDVQKVLMHARMAQRGLLQRDPVNESISLELDFLNIFVRMVQILMMQQS 333 Query: 145 RRK 137 RRK Sbjct: 334 RRK 336 >gb|EPE09791.1| bax inhibitor family protein [Ophiostoma piceae UAMH 11346] Length = 355 Score = 106 bits (265), Expect = 3e-21 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = -1 Query: 325 GGLAVFGGFTLYDTQKILAHARMAERGMFRRDAVNESIALELDFINIFVRMVQILAMQQG 146 GGLAVFGGFTLYD QK+L HAR+AERG+ +RD VNESI+LELDFINIF+RMVQIL MQQ Sbjct: 293 GGLAVFGGFTLYDVQKVLHHARLAERGVMKRDPVNESISLELDFINIFIRMVQILMMQQN 352 Query: 145 RRK 137 RRK Sbjct: 353 RRK 355