BLASTX nr result
ID: Cocculus22_contig00014472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014472 (642 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304277.2| hypothetical protein POPTR_0003s07480g [Popu... 58 3e-06 >ref|XP_002304277.2| hypothetical protein POPTR_0003s07480g [Populus trichocarpa] gi|550342631|gb|EEE79256.2| hypothetical protein POPTR_0003s07480g [Populus trichocarpa] Length = 1371 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/56 (60%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -3 Query: 640 GGSIGSFSPPNTNEIKSQGEALGMPPSSFVPNQYHTMTPSLSNGGSFG-DLHEVEL 476 G SFSPP E KSQGE L M PSSF+P+ H+MT +S+ GSFG DLHEVEL Sbjct: 1318 GSFSDSFSPPKAVESKSQGEMLSMSPSSFMPSN-HSMT-RMSSSGSFGDDLHEVEL 1371