BLASTX nr result
ID: Cocculus22_contig00014411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014411 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007017018.1| RNI-like superfamily protein isoform 4 [Theo... 77 3e-12 ref|XP_007017016.1| RNI-like superfamily protein isoform 2 [Theo... 77 3e-12 ref|XP_007017015.1| RNI-like superfamily protein isoform 1 [Theo... 77 3e-12 gb|EYU41974.1| hypothetical protein MIMGU_mgv1a002488mg [Mimulus... 76 6e-12 ref|XP_006363611.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 75 1e-11 ref|XP_004249058.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 75 1e-11 ref|XP_002526701.1| F-box protein, atfbl3, putative [Ricinus com... 75 1e-11 ref|XP_007017017.1| RNI-like superfamily protein isoform 3 [Theo... 73 5e-11 ref|XP_003516411.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 72 6e-11 ref|XP_003522022.2| PREDICTED: F-box/LRR-repeat protein 3-like [... 72 8e-11 ref|XP_007134623.1| hypothetical protein PHAVU_010G062400g [Phas... 72 8e-11 ref|XP_004506828.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 72 8e-11 ref|XP_002265215.1| PREDICTED: F-box/LRR-repeat protein 3 [Vitis... 72 8e-11 ref|XP_006429507.1| hypothetical protein CICLE_v10011244mg [Citr... 71 2e-10 ref|XP_007204970.1| hypothetical protein PRUPE_ppa002410mg [Prun... 70 3e-10 ref|XP_002323638.1| F-box family protein [Populus trichocarpa] g... 69 5e-10 ref|XP_004302549.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 69 7e-10 ref|XP_004296043.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 69 7e-10 ref|XP_002309168.1| F-box family protein [Populus trichocarpa] g... 69 7e-10 gb|EPS67415.1| hypothetical protein M569_07360 [Genlisea aurea] 68 1e-09 >ref|XP_007017018.1| RNI-like superfamily protein isoform 4 [Theobroma cacao] gi|508787381|gb|EOY34637.1| RNI-like superfamily protein isoform 4 [Theobroma cacao] Length = 668 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLHASFK +LPQ FL++ME+RGCVF WRDK FQ E+DP+ W+L Sbjct: 615 KVKLHASFKPLLPQSFLKYMEARGCVFHWRDKAFQKEMDPKGWKL 659 >ref|XP_007017016.1| RNI-like superfamily protein isoform 2 [Theobroma cacao] gi|508787379|gb|EOY34635.1| RNI-like superfamily protein isoform 2 [Theobroma cacao] Length = 676 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLHASFK +LPQ FL++ME+RGCVF WRDK FQ E+DP+ W+L Sbjct: 623 KVKLHASFKPLLPQSFLKYMEARGCVFHWRDKAFQKEMDPKGWKL 667 >ref|XP_007017015.1| RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508787378|gb|EOY34634.1| RNI-like superfamily protein isoform 1 [Theobroma cacao] Length = 683 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLHASFK +LPQ FL++ME+RGCVF WRDK FQ E+DP+ W+L Sbjct: 630 KVKLHASFKPLLPQSFLKYMEARGCVFHWRDKAFQKEMDPKGWKL 674 >gb|EYU41974.1| hypothetical protein MIMGU_mgv1a002488mg [Mimulus guttatus] Length = 667 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLHASFKS+LPQL +H+E+RGC FQWRDK FQ E+DP W+L Sbjct: 617 KVKLHASFKSVLPQLLFQHLEARGCNFQWRDKTFQAELDPMCWKL 661 >ref|XP_006363611.1| PREDICTED: F-box/LRR-repeat protein 3-like [Solanum tuberosum] Length = 675 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKL SFKS+LPQ L+H+ESRGCVFQWR+KPFQ EVDP W++ Sbjct: 625 KVKLQTSFKSLLPQPLLQHLESRGCVFQWREKPFQAEVDPIYWKI 669 >ref|XP_004249058.1| PREDICTED: F-box/LRR-repeat protein 3-like [Solanum lycopersicum] Length = 675 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKL SFKS+LPQ L+H+ESRGCVFQWR+KPFQ EVDP W++ Sbjct: 625 KVKLQTSFKSLLPQPLLQHLESRGCVFQWREKPFQAEVDPIYWKI 669 >ref|XP_002526701.1| F-box protein, atfbl3, putative [Ricinus communis] gi|223534001|gb|EEF35723.1| F-box protein, atfbl3, putative [Ricinus communis] Length = 669 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLHASFKS+LPQ EH+E+RGCVF+WRDK Q E+DP+ W+L Sbjct: 618 KVKLHASFKSLLPQPLFEHLEARGCVFEWRDKEIQAELDPKCWKL 662 >ref|XP_007017017.1| RNI-like superfamily protein isoform 3 [Theobroma cacao] gi|508787380|gb|EOY34636.1| RNI-like superfamily protein isoform 3 [Theobroma cacao] Length = 675 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLHASFK +LPQ FL++ME+RGCVF WRDK FQ E+DP+ W+L Sbjct: 623 KVKLHASFKPLLPQSFLKYMEARGCVFHWRDKAFQ-EMDPKGWKL 666 >ref|XP_003516411.1| PREDICTED: F-box/LRR-repeat protein 3-like [Glycine max] Length = 671 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH S + +LPQL + H+ESRGCVF+WRDK FQ E+DP+ W+L Sbjct: 620 KVKLHLSLRPLLPQLLIRHVESRGCVFEWRDKEFQAELDPKCWKL 664 >ref|XP_003522022.2| PREDICTED: F-box/LRR-repeat protein 3-like [Glycine max] Length = 708 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH S +S+LP+L + H+E+RGCVF+WRDK FQ E+DP+ W+L Sbjct: 658 KVKLHLSLRSLLPELLIRHVEARGCVFEWRDKEFQAELDPKCWKL 702 >ref|XP_007134623.1| hypothetical protein PHAVU_010G062400g [Phaseolus vulgaris] gi|561007668|gb|ESW06617.1| hypothetical protein PHAVU_010G062400g [Phaseolus vulgaris] Length = 667 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH S +S+LP+L + H+E+RGCVF+WRDK FQ E+DP+ W+L Sbjct: 617 KVKLHLSLRSLLPELLIRHVEARGCVFEWRDKEFQAELDPKCWKL 661 >ref|XP_004506828.1| PREDICTED: F-box/LRR-repeat protein 3-like [Cicer arietinum] Length = 662 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH S +S+LP+L + H+E+RGCVF+WRDK FQ E+DP+ W+L Sbjct: 611 KVKLHVSLRSLLPELLIRHVEARGCVFEWRDKVFQAELDPKCWKL 655 >ref|XP_002265215.1| PREDICTED: F-box/LRR-repeat protein 3 [Vitis vinifera] gi|297735597|emb|CBI18091.3| unnamed protein product [Vitis vinifera] Length = 663 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKL ASFKS+LPQ EH+E+RGC+FQWRDK FQ E+DP W+L Sbjct: 613 KVKLQASFKSLLPQPLFEHLEARGCMFQWRDKVFQAELDPICWKL 657 >ref|XP_006429507.1| hypothetical protein CICLE_v10011244mg [Citrus clementina] gi|568855057|ref|XP_006481127.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X1 [Citrus sinensis] gi|557531564|gb|ESR42747.1| hypothetical protein CICLE_v10011244mg [Citrus clementina] Length = 664 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/45 (62%), Positives = 39/45 (86%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKL A+FK +LPQ ++H+++RGCVFQWR+K FQ E+DP+SW+L Sbjct: 613 KVKLQAAFKQLLPQPLIDHLQARGCVFQWRNKVFQAELDPKSWKL 657 >ref|XP_007204970.1| hypothetical protein PRUPE_ppa002410mg [Prunus persica] gi|462400612|gb|EMJ06169.1| hypothetical protein PRUPE_ppa002410mg [Prunus persica] Length = 675 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKL A+FK++LPQ EH+E+RGCVFQWRDK F+ E+DP+ W++ Sbjct: 622 KVKLQATFKTLLPQALFEHLEARGCVFQWRDKFFRAELDPQCWKI 666 >ref|XP_002323638.1| F-box family protein [Populus trichocarpa] gi|222868268|gb|EEF05399.1| F-box family protein [Populus trichocarpa] Length = 668 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH SFKS+LP EH+E+RGCVF+WRDK FQ E+DP+ ++L Sbjct: 617 KVKLHLSFKSLLPLPLFEHLEARGCVFEWRDKEFQAELDPKCYKL 661 >ref|XP_004302549.1| PREDICTED: F-box/LRR-repeat protein 3-like [Fragaria vesca subsp. vesca] Length = 678 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKL A+FKS++PQ EH E+RGC+FQWRDK F+ E+DP+ W+L Sbjct: 627 KVKLQATFKSLVPQALFEHFEARGCLFQWRDKFFRAELDPQCWKL 671 >ref|XP_004296043.1| PREDICTED: F-box/LRR-repeat protein 3-like [Fragaria vesca subsp. vesca] Length = 665 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH S K +LP+ E+ME RGCVF WRDK FQ E+DP+ W+L Sbjct: 613 KVKLHTSLKPLLPKYIFEYMEGRGCVFHWRDKAFQVEIDPKGWQL 657 >ref|XP_002309168.1| F-box family protein [Populus trichocarpa] gi|222855144|gb|EEE92691.1| F-box family protein [Populus trichocarpa] Length = 666 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQDEVDPRSWRL 173 KVKLH SFKS+LPQ EH+E+R CVF+WRDK FQ E+DP+ ++L Sbjct: 615 KVKLHVSFKSLLPQPLFEHLEARCCVFEWRDKEFQAELDPKCYKL 659 >gb|EPS67415.1| hypothetical protein M569_07360 [Genlisea aurea] Length = 666 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/54 (51%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +3 Query: 39 KVKLHASFKSMLPQLFLEHMESRGCVFQWRDKPFQD-EVDPRSWRLSSRVTTNF 197 KVKLHA F+++LP + H+E+RGC FQWR+K F+D E+DP+ W+L S + F Sbjct: 612 KVKLHAVFRTLLPTVLFRHLEARGCTFQWRNKVFEDEELDPKCWKLQSSAQSQF 665