BLASTX nr result
ID: Cocculus22_contig00014231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00014231 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007012790.1| Regulatory protein isoform 1 [Theobroma caca... 57 3e-06 gb|ADI24348.1| non-expressor of PR1 [Theobroma cacao] 57 3e-06 >ref|XP_007012790.1| Regulatory protein isoform 1 [Theobroma cacao] gi|508783153|gb|EOY30409.1| Regulatory protein isoform 1 [Theobroma cacao] Length = 591 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 508 LSQLAYRGNDTPEQRLKKKQRYMEIHDMLADAFIKDKVE 392 LSQLA GNDTPE+RL KKQRY+E+ D+L+ AF +DKVE Sbjct: 522 LSQLACGGNDTPEERLVKKQRYVELQDVLSKAFNEDKVE 560 >gb|ADI24348.1| non-expressor of PR1 [Theobroma cacao] Length = 591 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 508 LSQLAYRGNDTPEQRLKKKQRYMEIHDMLADAFIKDKVE 392 LSQLA GNDTPE+RL KKQRY+E+ D+L+ AF +DKVE Sbjct: 522 LSQLACGGNDTPEERLVKKQRYVELQDVLSKAFNEDKVE 560