BLASTX nr result
ID: Cocculus22_contig00013903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00013903 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006664649.1| PREDICTED: pleiotropic drug resistance prote... 80 4e-13 ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resista... 77 3e-12 ref|XP_002443376.1| hypothetical protein SORBIDRAFT_08g018460 [S... 77 3e-12 ref|XP_002319469.1| hypothetical protein POPTR_0013s00630g [Popu... 72 8e-11 ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [A... 62 6e-08 >ref|XP_006664649.1| PREDICTED: pleiotropic drug resistance protein 1-like [Oryza brachyantha] Length = 933 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +1 Query: 1 GLSLERDGTLFFEYLILLFLVAYFGSSVFFFLSAVSPIPETGNALAGALFSV 156 GL++E DG +FFEYL L+FLVAYFGSS+FFFLSAVS IPE NALAG + S+ Sbjct: 75 GLTMENDGKVFFEYLFLMFLVAYFGSSIFFFLSAVSSIPEVANALAGLVVSI 126 >ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resistance protein 7-like [Vitis vinifera] Length = 1538 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +1 Query: 1 GLSLERDGTLFFEYLILLFLVAYFGSSVFFFLSAVSPIPETGNALAGALFSV 156 GL LE +G FFEYL+LLFLVA FGSSVFFFLSA+S IPE GNAL+G L S+ Sbjct: 687 GLPLEGNGAPFFEYLVLLFLVANFGSSVFFFLSAISSIPEIGNALSGLLISI 738 >ref|XP_002443376.1| hypothetical protein SORBIDRAFT_08g018460 [Sorghum bicolor] gi|241944069|gb|EES17214.1| hypothetical protein SORBIDRAFT_08g018460 [Sorghum bicolor] Length = 1532 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = +1 Query: 1 GLSLERDGTLFFEYLILLFLVAYFGSSVFFFLSAVSPIPETGNALAGALFSV 156 GL+LE +G F +YL+L+FLVAYFGSS FFFLSAV+PIPE NALAG + S+ Sbjct: 663 GLTLENNGVAFIDYLVLMFLVAYFGSSFFFFLSAVAPIPEAANALAGLIVSI 714 >ref|XP_002319469.1| hypothetical protein POPTR_0013s00630g [Populus trichocarpa] gi|222857845|gb|EEE95392.1| hypothetical protein POPTR_0013s00630g [Populus trichocarpa] Length = 1605 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +1 Query: 1 GLSLERDGTLFFEYLILLFLVAYFGSSVFFFLSAVSPIPETGNALAGALFSV 156 GLS+ G+ F YL LLFLVAYFGSSVFFFLS +S IPE GNALAG L S+ Sbjct: 757 GLSMAGKGSPLFAYLALLFLVAYFGSSVFFFLSTISSIPEVGNALAGLLVSI 808 >ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] gi|548843610|gb|ERN03264.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] Length = 1620 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +1 Query: 1 GLSLERDGTLFFEYLILLFLVAYFGSSVFFFLSAVSPIPETGNALAGALFS 153 GLSL +G +F EYL+LLFLV +FGSS+ F +SA+S I E G+ALAG + S Sbjct: 775 GLSLVANGVIFLEYLLLLFLVDFFGSSLIFLISAISSISEMGSALAGLIVS 825