BLASTX nr result
ID: Cocculus22_contig00013264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00013264 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019173.1| Tetratricopeptide repeat (TPR)-like superfam... 164 9e-39 ref|XP_004149431.1| PREDICTED: pentatricopeptide repeat-containi... 158 7e-37 ref|XP_006472835.1| PREDICTED: pentatricopeptide repeat-containi... 158 9e-37 ref|XP_006434266.1| hypothetical protein CICLE_v10000990mg [Citr... 157 1e-36 ref|XP_002284592.2| PREDICTED: pentatricopeptide repeat-containi... 156 3e-36 emb|CBI18974.3| unnamed protein product [Vitis vinifera] 156 3e-36 gb|EYU18727.1| hypothetical protein MIMGU_mgv1a027101mg [Mimulus... 156 3e-36 ref|XP_002307458.2| pentatricopeptide repeat-containing family p... 156 3e-36 ref|XP_004502524.1| PREDICTED: pentatricopeptide repeat-containi... 155 4e-36 ref|XP_007137466.1| hypothetical protein PHAVU_009G129200g [Phas... 155 6e-36 ref|XP_007224224.1| hypothetical protein PRUPE_ppa017885mg [Prun... 155 6e-36 ref|XP_002520317.1| pentatricopeptide repeat-containing protein,... 154 1e-35 ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containi... 150 2e-34 ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containi... 150 2e-34 ref|XP_004300124.1| PREDICTED: pentatricopeptide repeat-containi... 150 2e-34 ref|XP_006340242.1| PREDICTED: pentatricopeptide repeat-containi... 147 2e-33 ref|XP_006849933.1| hypothetical protein AMTR_s00022p00121040 [A... 147 2e-33 ref|XP_004251179.1| PREDICTED: pentatricopeptide repeat-containi... 147 2e-33 ref|XP_006301167.1| hypothetical protein CARUB_v10021564mg, part... 146 3e-33 gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thal... 144 1e-32 >ref|XP_007019173.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599410|ref|XP_007019174.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599414|ref|XP_007019175.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599418|ref|XP_007019176.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599423|ref|XP_007019177.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724501|gb|EOY16398.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724502|gb|EOY16399.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724503|gb|EOY16400.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724504|gb|EOY16401.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724505|gb|EOY16402.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 480 Score = 164 bits (416), Expect = 9e-39 Identities = 78/97 (80%), Positives = 88/97 (90%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 GI+NRI DAVD FLEMERNG ADV VYNALIGAFCKVN+LKN +RVL+EMD KGVAPN+ Sbjct: 281 GIENRIEDAVDAFLEMERNGIKADVVVYNALIGAFCKVNKLKNVYRVLNEMDSKGVAPNA 340 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+SLIG+GETD+AF+VFR+MIK CEPD DTY Sbjct: 341 RTCNIILNSLIGRGETDEAFKVFRRMIKECEPDADTY 377 >ref|XP_004149431.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] gi|449499065|ref|XP_004160711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 439 Score = 158 bits (400), Expect = 7e-37 Identities = 72/97 (74%), Positives = 87/97 (89%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++NRI DAV TFLEMERNG MADVA YNALI AFCK N++KN +RVL +MD KGV PNS Sbjct: 240 GVENRIEDAVSTFLEMERNGVMADVAAYNALISAFCKANKMKNVYRVLKDMDLKGVNPNS 299 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNII++SLIG+GETD+AF++FR+MIK+CEPDVD+Y Sbjct: 300 RTCNIIINSLIGRGETDEAFKIFRRMIKVCEPDVDSY 336 >ref|XP_006472835.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Citrus sinensis] gi|568837650|ref|XP_006472836.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Citrus sinensis] gi|568837652|ref|XP_006472837.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Citrus sinensis] gi|568837654|ref|XP_006472838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Citrus sinensis] Length = 480 Score = 158 bits (399), Expect = 9e-37 Identities = 72/97 (74%), Positives = 87/97 (89%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++NRI DAVDTFLEME+NG +ADVA+YNALIGAFCK N+ KN +RVL +M+ KGVAPNS Sbjct: 281 GVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNS 340 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+ LIG+GETD+A+RVFR+MIK+CE D DTY Sbjct: 341 RTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTY 377 >ref|XP_006434266.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883417|ref|XP_006434267.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883419|ref|XP_006434268.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883421|ref|XP_006434269.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883423|ref|XP_006434270.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536388|gb|ESR47506.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536389|gb|ESR47507.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536390|gb|ESR47508.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536391|gb|ESR47509.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536392|gb|ESR47510.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] Length = 480 Score = 157 bits (397), Expect = 1e-36 Identities = 72/97 (74%), Positives = 86/97 (88%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++NRI DAVDTFLEME+NG ADVA+YNALIGAFCK N+ KN +RVL +M+ KGVAPNS Sbjct: 281 GVENRIEDAVDTFLEMEKNGIQADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNS 340 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+ LIG+GETD+A+RVFR+MIK+CE D DTY Sbjct: 341 RTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTY 377 >ref|XP_002284592.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] Length = 476 Score = 156 bits (395), Expect = 3e-36 Identities = 75/97 (77%), Positives = 87/97 (89%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 GI+NRI DAV TFL+MERN ADVAVYNALIGAFCKVN+LKNA+RVL+EMD KG+ PNS Sbjct: 261 GIENRIEDAVYTFLDMERNEIEADVAVYNALIGAFCKVNKLKNAYRVLNEMDCKGIRPNS 320 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+SLI G+TD+AFRVFR+MIK+C+PD DTY Sbjct: 321 RTCNIILNSLISCGDTDEAFRVFRRMIKVCDPDADTY 357 >emb|CBI18974.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 156 bits (395), Expect = 3e-36 Identities = 75/97 (77%), Positives = 87/97 (89%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 GI+NRI DAV TFL+MERN ADVAVYNALIGAFCKVN+LKNA+RVL+EMD KG+ PNS Sbjct: 109 GIENRIEDAVYTFLDMERNEIEADVAVYNALIGAFCKVNKLKNAYRVLNEMDCKGIRPNS 168 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+SLI G+TD+AFRVFR+MIK+C+PD DTY Sbjct: 169 RTCNIILNSLISCGDTDEAFRVFRRMIKVCDPDADTY 205 >gb|EYU18727.1| hypothetical protein MIMGU_mgv1a027101mg [Mimulus guttatus] Length = 497 Score = 156 bits (394), Expect = 3e-36 Identities = 70/97 (72%), Positives = 89/97 (91%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 GI+NRI DA+DTFL+MERNG +ADVAVYNALI AFCKVN+ KNA++V+DEM++KGV+PNS Sbjct: 298 GIENRIEDAIDTFLQMERNGVIADVAVYNALISAFCKVNKFKNAYKVVDEMEKKGVSPNS 357 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNI+++ LIG+ ETD+AF+VFR++ KICEPD DTY Sbjct: 358 RTCNILINGLIGREETDEAFKVFRRLSKICEPDADTY 394 >ref|XP_002307458.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550339385|gb|EEE94454.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 478 Score = 156 bits (394), Expect = 3e-36 Identities = 76/97 (78%), Positives = 84/97 (86%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 GI+NRI DAV TFLEME NG DVAVYNALIGAFCK NRLKN +RVL+EMD KGV PNS Sbjct: 278 GIENRIEDAVSTFLEMENNGIEPDVAVYNALIGAFCKANRLKNVYRVLNEMDCKGVTPNS 337 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RT NIILSSLIG+GETD+A+RVF +MIK+CEPD DTY Sbjct: 338 RTFNIILSSLIGRGETDEAYRVFLRMIKVCEPDADTY 374 >ref|XP_004502524.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Cicer arietinum] gi|502135996|ref|XP_004502525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Cicer arietinum] gi|502135999|ref|XP_004502526.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Cicer arietinum] Length = 480 Score = 155 bits (393), Expect = 4e-36 Identities = 71/97 (73%), Positives = 85/97 (87%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++NRI DA+DTF+EMERNG ADV VYNALI AFCK N++KN RVL EM++KG+APNS Sbjct: 281 GVENRIEDAIDTFMEMERNGVEADVVVYNALISAFCKANKIKNVHRVLKEMEKKGIAPNS 340 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCN+I++SLI QGETDKAF VFR+MIK+CEPD DTY Sbjct: 341 RTCNVIMTSLITQGETDKAFIVFRRMIKLCEPDADTY 377 >ref|XP_007137466.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] gi|593328080|ref|XP_007137467.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] gi|561010553|gb|ESW09460.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] gi|561010554|gb|ESW09461.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] Length = 480 Score = 155 bits (392), Expect = 6e-36 Identities = 71/97 (73%), Positives = 84/97 (86%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G+++RI DA+DTF EMER G ADV VYNALIGAFCKVN+ KN RVL EM+ GVAPNS Sbjct: 281 GVEHRIEDAIDTFQEMERKGIKADVVVYNALIGAFCKVNKFKNVHRVLQEMEINGVAPNS 340 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCN+I+SS+IGQG+TD+AFRVFR+MIK+CEPD DTY Sbjct: 341 RTCNVIISSMIGQGQTDRAFRVFRRMIKLCEPDADTY 377 >ref|XP_007224224.1| hypothetical protein PRUPE_ppa017885mg [Prunus persica] gi|462421160|gb|EMJ25423.1| hypothetical protein PRUPE_ppa017885mg [Prunus persica] Length = 464 Score = 155 bits (392), Expect = 6e-36 Identities = 72/97 (74%), Positives = 84/97 (86%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G+++RI DAVD FLEMERNG ADV VYNALIGAFCK N+ KN +RVL++MD KGV PNS Sbjct: 265 GVEHRIEDAVDAFLEMERNGIKADVVVYNALIGAFCKANKFKNVYRVLNDMDSKGVKPNS 324 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+SLI +GETD+AF VFR+MIK+CEPD DTY Sbjct: 325 RTCNIILNSLIDRGETDEAFSVFRKMIKLCEPDADTY 361 >ref|XP_002520317.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540536|gb|EEF42103.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 439 Score = 154 bits (390), Expect = 1e-35 Identities = 73/97 (75%), Positives = 85/97 (87%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 GI+NRI DAVDTFL ME+NG ADVA YNALIGAFCKVN+ KN +RVL+EMD KG+ PNS Sbjct: 240 GIENRIEDAVDTFLGMEKNGVKADVAAYNALIGAFCKVNKFKNVYRVLNEMDYKGMQPNS 299 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RT NIIL++LI +GETD+AFRVFR+MIK+CEPD DTY Sbjct: 300 RTLNIILNNLIARGETDEAFRVFRRMIKVCEPDADTY 336 >ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Glycine max] Length = 454 Score = 150 bits (379), Expect = 2e-34 Identities = 68/97 (70%), Positives = 82/97 (84%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G+++RI DA+DTFLEM + G ADV YNALIGAFCKVN+ KN RVL EM+ GVAPNS Sbjct: 255 GVEHRIEDAIDTFLEMAKKGIKADVVAYNALIGAFCKVNKFKNVHRVLKEMESNGVAPNS 314 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCN+I+SS+IGQG+TD+AFRVF +MIK+CEPD DTY Sbjct: 315 RTCNVIISSMIGQGQTDRAFRVFCRMIKLCEPDADTY 351 >ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Glycine max] gi|571460055|ref|XP_006581592.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Glycine max] gi|571460057|ref|XP_006581593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Glycine max] gi|571460059|ref|XP_006581594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X5 [Glycine max] gi|571460061|ref|XP_006581595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X6 [Glycine max] Length = 481 Score = 150 bits (379), Expect = 2e-34 Identities = 68/97 (70%), Positives = 82/97 (84%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G+++RI DA+DTFLEM + G ADV YNALIGAFCKVN+ KN RVL EM+ GVAPNS Sbjct: 282 GVEHRIEDAIDTFLEMAKKGIKADVVAYNALIGAFCKVNKFKNVHRVLKEMESNGVAPNS 341 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCN+I+SS+IGQG+TD+AFRVF +MIK+CEPD DTY Sbjct: 342 RTCNVIISSMIGQGQTDRAFRVFCRMIKLCEPDADTY 378 >ref|XP_004300124.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 484 Score = 150 bits (379), Expect = 2e-34 Identities = 70/97 (72%), Positives = 82/97 (84%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G+++RI DAV+ FLEMERNG ADVA+YNALIGAFCKVN+ KN +RVL +M K V PNS Sbjct: 285 GVEDRIEDAVEAFLEMERNGIKADVAIYNALIGAFCKVNKFKNVYRVLSDMKSKAVVPNS 344 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL SLI +GETD+AF VFR+MIKIC+PD DTY Sbjct: 345 RTCNIILHSLIDRGETDEAFSVFRKMIKICDPDADTY 381 >ref|XP_006340242.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Solanum tuberosum] Length = 478 Score = 147 bits (371), Expect = 2e-33 Identities = 67/97 (69%), Positives = 83/97 (85%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++NRI DA+DTFLEME+NG ADVAVYN+LI AFCKVN+ +N + VL++M KGV PN+ Sbjct: 279 GLENRIEDAIDTFLEMEKNGVEADVAVYNSLISAFCKVNKFQNVYMVLNDMQFKGVTPNA 338 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIILS LI +GETD AF+VFR+M+KIC+PD DTY Sbjct: 339 RTCNIILSGLIARGETDDAFKVFRRMLKICDPDADTY 375 >ref|XP_006849933.1| hypothetical protein AMTR_s00022p00121040 [Amborella trichopoda] gi|548853531|gb|ERN11514.1| hypothetical protein AMTR_s00022p00121040 [Amborella trichopoda] Length = 438 Score = 147 bits (371), Expect = 2e-33 Identities = 67/97 (69%), Positives = 81/97 (83%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++ IGDAVD+FLEME++G ADVA YNALI AFC+ + KN +RVL+EMD+K VAPNS Sbjct: 239 GVERSIGDAVDSFLEMEKDGIKADVAAYNALISAFCRAKKFKNVYRVLEEMDKKSVAPNS 298 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIIL+ LIG GETD+AFR+F+ MIK CEPD DTY Sbjct: 299 RTCNIILNGLIGSGETDEAFRIFKSMIKHCEPDSDTY 335 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/95 (34%), Positives = 55/95 (57%), Gaps = 1/95 (1%) Frame = -2 Query: 282 NRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNSRTC 103 +++ +AV TF M++ G ++ +N+L+ AFCK ++ A + D+M + PNS T Sbjct: 103 HKVDEAVYTFNVMDKFGLTPNLTAFNSLLSAFCKAKNVRKAQEIFDDMKDR-FEPNSITY 161 Query: 102 NIILSSLIGQGETDKAFRVFRQMI-KICEPDVDTY 1 +I+L + KA +F +MI K CEPD+ TY Sbjct: 162 SILLEGWGKEPNLPKAREIFLEMIDKNCEPDIVTY 196 >ref|XP_004251179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Solanum lycopersicum] Length = 478 Score = 147 bits (371), Expect = 2e-33 Identities = 66/97 (68%), Positives = 84/97 (86%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G++NRI DA+DTFLEME+NG ADVAVYN+LI AFCKVN+ +N + VL++M KGV+PN+ Sbjct: 279 GLENRIEDAIDTFLEMEKNGVEADVAVYNSLISAFCKVNKFQNVYMVLNDMQIKGVSPNA 338 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 RTCNIILS LI +GETD AF++FR+M+KIC+PD DTY Sbjct: 339 RTCNIILSGLIARGETDDAFKIFRRMLKICDPDADTY 375 >ref|XP_006301167.1| hypothetical protein CARUB_v10021564mg, partial [Capsella rubella] gi|482569877|gb|EOA34065.1| hypothetical protein CARUB_v10021564mg, partial [Capsella rubella] Length = 486 Score = 146 bits (369), Expect = 3e-33 Identities = 67/97 (69%), Positives = 82/97 (84%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G +NR+ +AVDTFLEMER+G ADVA++N+LIGAFCK NR+KN +RVL EM KGV PNS Sbjct: 287 GTENRLEEAVDTFLEMERSGMKADVAIFNSLIGAFCKANRMKNVYRVLKEMKNKGVTPNS 346 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 ++CNIIL LI +GETD+AF VFR+MIK+CEPD DTY Sbjct: 347 KSCNIILRHLIDRGETDEAFDVFRKMIKVCEPDADTY 383 >gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thaliana] Length = 481 Score = 144 bits (363), Expect = 1e-32 Identities = 67/97 (69%), Positives = 81/97 (83%) Frame = -2 Query: 291 GIDNRIGDAVDTFLEMERNGFMADVAVYNALIGAFCKVNRLKNAFRVLDEMDQKGVAPNS 112 G +NR+ +AVDTFLEMER+G ADVAV+N+LIGAFCK NR+KN +RVL EM KGV PNS Sbjct: 282 GTENRLEEAVDTFLEMERSGMKADVAVFNSLIGAFCKANRMKNVYRVLKEMKSKGVTPNS 341 Query: 111 RTCNIILSSLIGQGETDKAFRVFRQMIKICEPDVDTY 1 ++CNIIL LI +GE D+AF VFR+MIK+CEPD DTY Sbjct: 342 KSCNIILRHLIERGEKDEAFDVFRKMIKVCEPDADTY 378