BLASTX nr result
ID: Cocculus22_contig00013203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00013203 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC21216.1| hypothetical protein L484_002226 [Morus notabilis] 65 1e-08 >gb|EXC21216.1| hypothetical protein L484_002226 [Morus notabilis] Length = 1018 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +1 Query: 226 KGKKRSKSGDV-IDTLNNIVSQFSAMYAASSENMGRIANYF*NEVDSSNRRMTINDELRK 402 K +KRS+SGDV +D L V +FS MYA EN+GR+AN F E DS+ RRM + DE++K Sbjct: 99 KKRKRSQSGDVLVDALIETVQKFSNMYAMVGENIGRLANCFQYEADSATRRMQVFDEVKK 158 Query: 403 IEGLTVPDR 429 G P + Sbjct: 159 FVGYMAPSK 167