BLASTX nr result
ID: Cocculus22_contig00013149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00013149 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 73 4e-11 ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 59 7e-07 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 2/50 (4%) Frame = +1 Query: 7 RDVAQLGSAFVLGTKCHGFKSCHPYLLLFLWALMKNQLISIQIG--PFFF 150 RDVAQLGSAFVLGTKCHGFKSCHPYLLL A+ +N++ SI+I P+F+ Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRSIEIARTPYFY 50 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = +1 Query: 1 IERDVAQLGSAFVLGTKCHGFKSCHPYLLLFLWAL--MKNQLISIQIGPFFFIKLYAYKL 174 I RDVAQLGS FVLGTKC FKSCHPYL L + K+ LISI+ I+ Y + Sbjct: 2 IRRDVAQLGSVFVLGTKCRRFKSCHPYLSLLFYGKKGTKDHLISIR-REHQIIESYQMRK 60 Query: 175 YLEVQ 189 YL ++ Sbjct: 61 YLTLR 65