BLASTX nr result
ID: Cocculus22_contig00012608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00012608 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006859070.1| hypothetical protein AMTR_s00068p00200420 [A... 58 1e-06 >ref|XP_006859070.1| hypothetical protein AMTR_s00068p00200420 [Amborella trichopoda] gi|548863182|gb|ERN20537.1| hypothetical protein AMTR_s00068p00200420 [Amborella trichopoda] Length = 380 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 8/92 (8%) Frame = -1 Query: 254 KIKFWFGYRYQRVSPDCLHLNNGRKSSNLRTTYKEDEDGTTENGKIVPSYSFD------- 96 ++ F G RYQRVSPDCLHL+NGRK S LR ++D +G+ N + +Y+ + Sbjct: 4 QVSFLHGCRYQRVSPDCLHLSNGRKPS-LRICKEDDIEGSNGNNGKIQTYNHNPLNGFPR 62 Query: 95 -GKAAAAAAHPLRYNRSSTTPPRQDHHHHNNN 3 ++ + Y S + P+ +++H NNN Sbjct: 63 IRTTPSSTSQDHNYAPSVSETPQTENNHDNNN 94