BLASTX nr result
ID: Cocculus22_contig00012590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00012590 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP80272.1| ATP-dependent Clp protease proteolytic subunit [M... 63 4e-08 ref|XP_007209429.1| hypothetical protein PRUPE_ppa009510mg [Prun... 62 6e-08 ref|XP_007040010.1| CLP protease proteolytic subunit 2 [Theobrom... 59 7e-07 gb|EXC17843.1| ATP-dependent Clp protease proteolytic subunit-re... 59 9e-07 ref|XP_007155602.1| hypothetical protein PHAVU_003G215800g [Phas... 58 1e-06 ref|XP_002266380.1| PREDICTED: ATP-dependent Clp protease proteo... 58 2e-06 gb|EYU30468.1| hypothetical protein MIMGU_mgv1a0125612mg, partia... 57 3e-06 ref|XP_004515759.1| PREDICTED: ATP-dependent Clp protease proteo... 57 3e-06 ref|XP_003549891.1| PREDICTED: ATP-dependent Clp protease proteo... 57 3e-06 ref|XP_003525778.1| PREDICTED: ATP-dependent Clp protease proteo... 57 3e-06 ref|XP_006305499.1| hypothetical protein CARUB_v10009963mg [Caps... 55 8e-06 ref|XP_004298706.1| PREDICTED: ATP-dependent Clp protease proteo... 55 8e-06 >gb|AAP80272.1| ATP-dependent Clp protease proteolytic subunit [Malus domestica] Length = 120 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDRV+RPPRIKADAPPKD+ +GLG Sbjct: 89 QEALEYGLIDRVVRPPRIKADAPPKDSGSGLG 120 >ref|XP_007209429.1| hypothetical protein PRUPE_ppa009510mg [Prunus persica] gi|462405164|gb|EMJ10628.1| hypothetical protein PRUPE_ppa009510mg [Prunus persica] Length = 289 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDRV+RPPRIKADAPPKD GLG Sbjct: 258 QEALEYGLIDRVVRPPRIKADAPPKDAGTGLG 289 >ref|XP_007040010.1| CLP protease proteolytic subunit 2 [Theobroma cacao] gi|508777255|gb|EOY24511.1| CLP protease proteolytic subunit 2 [Theobroma cacao] Length = 279 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDRV+RPPRIKADAP KD GLG Sbjct: 248 QEALEYGLIDRVVRPPRIKADAPRKDAGTGLG 279 >gb|EXC17843.1| ATP-dependent Clp protease proteolytic subunit-related protein 2 [Morus notabilis] Length = 289 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDR++RPPRIKADAP KD GLG Sbjct: 258 QEALEYGLIDRIVRPPRIKADAPRKDAGTGLG 289 >ref|XP_007155602.1| hypothetical protein PHAVU_003G215800g [Phaseolus vulgaris] gi|561028956|gb|ESW27596.1| hypothetical protein PHAVU_003G215800g [Phaseolus vulgaris] Length = 284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGL+DR++RPPRIKADAP KD GLG Sbjct: 253 QEALEYGLVDRIVRPPRIKADAPRKDAGTGLG 284 >ref|XP_002266380.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic [Vitis vinifera] gi|147794105|emb|CAN62361.1| hypothetical protein VITISV_031921 [Vitis vinifera] gi|297742668|emb|CBI34817.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDR++RPPR+KADAP KD GLG Sbjct: 260 QEALEYGLIDRILRPPRVKADAPRKDAGTGLG 291 >gb|EYU30468.1| hypothetical protein MIMGU_mgv1a0125612mg, partial [Mimulus guttatus] Length = 100 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDR++RP RIKADAP KD+ AGLG Sbjct: 69 QEALEYGLIDRIVRPHRIKADAPRKDSTAGLG 100 >ref|XP_004515759.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic-like [Cicer arietinum] Length = 283 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLID+V+RP RIKADAPPKD G+G Sbjct: 252 QEALEYGLIDKVVRPRRIKADAPPKDAGTGIG 283 >ref|XP_003549891.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic-like isoform X1 [Glycine max] Length = 285 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDR++RPPRIKADAP K+ GLG Sbjct: 254 QEALEYGLIDRIVRPPRIKADAPRKEAGTGLG 285 >ref|XP_003525778.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic-like [Glycine max] Length = 312 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDR++RPPRIKADAP K+ GLG Sbjct: 281 QEALEYGLIDRIVRPPRIKADAPRKEAGTGLG 312 >ref|XP_006305499.1| hypothetical protein CARUB_v10009963mg [Capsella rubella] gi|482574210|gb|EOA38397.1| hypothetical protein CARUB_v10009963mg [Capsella rubella] Length = 279 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 +EA+EYGLID+++RPPRIKADAP +D +AGLG Sbjct: 248 EEAIEYGLIDKIVRPPRIKADAPRQDESAGLG 279 >ref|XP_004298706.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 287 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 1 QEALEYGLIDRVIRPPRIKADAPPKDTNAGLG 96 QEALEYGLIDRV+RPPRIKAD+P ++ GLG Sbjct: 256 QEALEYGLIDRVVRPPRIKADSPSREAGTGLG 287