BLASTX nr result
ID: Cocculus22_contig00012550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00012550 (585 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, part... 56 8e-06 ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, part... 56 8e-06 >ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] gi|462421226|gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] Length = 1117 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +2 Query: 428 DDIEVSHLQYADDALLFLNGVQSNVLEGIDLVKAFCWILGLKINLAKSQLLG 583 D +EVSHLQ+ADD + L+G + L + L+K FC + G+KIN AKS +LG Sbjct: 655 DQVEVSHLQFADDTIFLLDGKEEYWLNLLQLLKLFCEVSGMKINKAKSCILG 706 >ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] gi|462401888|gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] Length = 928 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +2 Query: 428 DDIEVSHLQYADDALLFLNGVQSNVLEGIDLVKAFCWILGLKINLAKSQLLG 583 D +EVSHLQ+ADD + L+G + L + L+K FC + G+KIN AKS +LG Sbjct: 419 DQVEVSHLQFADDTIFLLDGKEEYWLNLLQLLKLFCEVSGMKINKAKSCILG 470