BLASTX nr result
ID: Cocculus22_contig00012536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00012536 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC57961.1| putative C-4 sterol methyl oxidase [Aster tripol... 56 5e-06 >dbj|BAC57961.1| putative C-4 sterol methyl oxidase [Aster tripolium] Length = 297 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 219 MLPYQSLQEAEQALGRELTYAETLWFNYSA 308 MLPY SLQEAE A+GR LT+AETLWFNYSA Sbjct: 1 MLPYSSLQEAEAAMGRSLTFAETLWFNYSA 30