BLASTX nr result
ID: Cocculus22_contig00011560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00011560 (829 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB55632.1| hypothetical protein L484_003489 [Morus notabilis] 58 4e-06 >gb|EXB55632.1| hypothetical protein L484_003489 [Morus notabilis] Length = 133 Score = 58.2 bits (139), Expect = 4e-06 Identities = 36/92 (39%), Positives = 49/92 (53%) Frame = -3 Query: 572 MNTLIRNATLTMSRRSQYYESLAHQNDQDHQRPSDQGKNIIGIRAWSSSRRKSQRAAGHH 393 MNTL+R+ T ++SRR YE L H +D H +P G RA+S +++S R Sbjct: 1 MNTLVRSTTASLSRRFDGYEPLDHDHDHHHHQP--------GWRAFSKRKKESHR----- 47 Query: 392 LQLPNAINLPLSFSCRRDRAKKRLIFLRSYQL 297 +P S S R +RAK R IFL SY+L Sbjct: 48 --------MPYSRSYRNERAKHRRIFLNSYKL 71